DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set2 and Suv39h2

DIOPT Version :9

Sequence 1:NP_572888.2 Gene:Set2 / 32301 FlyBaseID:FBgn0030486 Length:2362 Species:Drosophila melanogaster
Sequence 2:NP_073561.2 Gene:Suv39h2 / 64707 MGIID:1890396 Length:477 Species:Mus musculus


Alignment Length:246 Identity:84/246 - (34%)
Similarity:106/246 - (43%) Gaps:48/246 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1344 NFYRCARQVS-QENAEMQC---DCFLTGDEEAQGHLSCGAGCI---NRMLMI---------ECGP 1392
            |.||.|..:| ...|...|   |||......|:      ||.:   |:...|         ||..
Mouse   240 NEYRPAPGISINSEATFGCSCTDCFFDKCCPAE------AGVVLAYNKKQQIKIQPGTPIYECNS 298

  Fly  1393 LCSNGARCTNKRFQQHQCWPCRVFRTEKKGCGITAELL--IPPGEFIMEYVGEVIDSEEFERRQH 1455
            .|..|..|.|:..|:...:...:||| ..|||...:.|  |....|:||||||||.|||.|||..
Mouse   299 RCRCGPECPNRIVQKGTQYSLCIFRT-SNGCGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQ 362

  Fly  1456 LYSKDRNRHYYFMAL---RGEAVIDATSKGNISRYINHSCDPNAETQKWTVNG---EL-RIGFFS 1513
            .|  |.....|...|   ..|..:||...||:|.::|||||||.:.....::.   .| ||..||
Mouse   363 FY--DNKGITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFSVFIDNLDTRLPRIALFS 425

  Fly  1514 VKPIQPGEEITFDYQYLRYG--------------RDAQRCYCEAANCRGWI 1550
            .:.|..|||:|||||....|              |...:|.|.|..|||::
Mouse   426 TRTINAGEELTFDYQMKGSGEASSDSIDHSPAKKRVRTQCKCGAETCRGYL 476

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Set2NP_572888.2 AWS 1358..1410 CDD:197795 16/66 (24%)
SET 1414..1533 CDD:214614 54/127 (43%)
PostSET 1535..1551 CDD:214703 6/16 (38%)
WW 2014..2043 CDD:278809
SRI 2270..2348 CDD:285448
Suv39h2NP_073561.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..59
Chromo 119..164 CDD:278797
Pre-SET 221..309 CDD:282838 20/74 (27%)
SET 317..446 CDD:214614 54/131 (41%)
S-adenosyl-L-methionine binding. /evidence=ECO:0000250 328..330 1/1 (100%)