DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set2 and setmar

DIOPT Version :9

Sequence 1:NP_572888.2 Gene:Set2 / 32301 FlyBaseID:FBgn0030486 Length:2362 Species:Drosophila melanogaster
Sequence 2:NP_001107072.1 Gene:setmar / 564575 ZFINID:ZDB-GENE-080204-61 Length:293 Species:Danio rerio


Alignment Length:320 Identity:89/320 - (27%)
Similarity:126/320 - (39%) Gaps:78/320 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1319 LANIEAINEQFLRSEGLNTFQLLKENFY--------------RCARQVSQENAEMQCDCFLTG-- 1367
            |.|:..:.|..:..|.|:.||.:.||..              .|:.:| |.....:|.|...|  
Zfish    12 LENVPVLIENSVPKEALSYFQYVPENVQGPGCDLDPNAVTLPGCSCRV-QSCFPERCPCLRFGQT 75

  Fly  1368 -DEEAQGHLSCGAGCINR--------MLMIECGPLCSNGARCTNKRFQQHQCWPCRVFRTEKKGC 1423
             |..|         |:|:        ..:.||...||.|..|..:..|...|....||.|..:|.
Zfish    76 YDSRA---------CLNQHPQDATYSRPVFECNAFCSCGESCQTRVVQNGVCVRLGVFSTADRGL 131

  Fly  1424 GITAELLIPPGEFIMEYVGEVIDSEEFERRQHLYSKDRNRHYYFMALR--------GEAVIDATS 1480
            |:.|...:|.|.|:.||.||||..:|..|||  .|:......|.:|::        .:..:|..:
Zfish   132 GVEALERLPCGRFVCEYAGEVIGIDEARRRQ--LSQTPLHMNYIIAVQEHKGLDRVTQTFVDPVN 194

  Fly  1481 KGNISRYINHSCDPNAETQKWTVNGEL-RIGFFSVKPIQPGEEITFDYQYLRYGRDAQRCYCEAA 1544
            .||:.|:|||||.||.......|:..| |:..|:.:.|:..||:||||.                
Zfish   195 LGNVGRFINHSCQPNLIMLPVRVHSVLPRLALFANRDIECYEELTFDYS---------------- 243

  Fly  1545 NCRGWIGGEPDSDEGEQLDEESDSDAEMDEEELEAEPEEGQPRKSAKAKAKSKLKAKLPL 1604
                  ||:..|.|..:||||:...|  |.||:        |:|.......|.....|||
Zfish   244 ------GGQNSSAETAKLDEETHVGA--DGEEI--------PQKKVCRCGASNCSGFLPL 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Set2NP_572888.2 AWS 1358..1410 CDD:197795 14/62 (23%)
SET 1414..1533 CDD:214614 44/127 (35%)
PostSET 1535..1551 CDD:214703 0/15 (0%)
WW 2014..2043 CDD:278809
SRI 2270..2348 CDD:285448
setmarNP_001107072.1 Pre-SET 8..111 CDD:282838 25/108 (23%)
SET 119..243 CDD:214614 43/125 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593871
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.