DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set2 and Setmar

DIOPT Version :10

Sequence 1:NP_572888.2 Gene:Set2 / 32301 FlyBaseID:FBgn0030486 Length:2362 Species:Drosophila melanogaster
Sequence 2:NP_001020219.1 Gene:Setmar / 500281 RGDID:1565882 Length:315 Species:Rattus norvegicus


Alignment Length:183 Identity:64/183 - (34%)
Similarity:93/183 - (50%) Gaps:26/183 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1387 MIECGPLCSNGARCTNKRFQQHQCWPCRVFRTEKKGCGITAELLIPPGEFIMEYVGEVIDSEEFE 1451
            :.||..||..|..|.|:..|....:..:||:|||||.|:.....||.|.|:.||.|||:...|.:
  Rat   116 VFECNVLCQCGEHCRNRVVQSGLQFLLQVFQTEKKGWGLRTLEYIPKGRFVCEYAGEVLGFSEVQ 180

  Fly  1452 RRQHLY-SKDRNRHYYFMALRG--------EAVIDATSKGNISRYINHSCDPNAETQKWTVNGEL 1507
            ||.||. :.|.|   |.:|||.        |..:|.|..|||.|::||||:||.......::..:
  Rat   181 RRIHLQTAHDPN---YIIALREHTYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMV 242

  Fly  1508 -RIGFFSVKPIQPGEEITFDY-------------QYLRYGRDAQRCYCEAANC 1546
             ::..|:.|.|.||||:::||             :.:..|:..:.|||.|.:|
  Rat   243 PKLALFAAKDILPGEELSYDYSGRFLNQISSKDKERIDCGQPRKPCYCGAQSC 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Set2NP_572888.2 valS <709..832 CDD:237855
AWS 1358..1410 CDD:197795 8/22 (36%)
SET_SETD2 1410..1551 CDD:380949 56/160 (35%)
WW 2014..2043 CDD:459800
SRI 2266..2355 CDD:462404
SetmarNP_001020219.1 SET_SETMAR 50..304 CDD:380942 64/183 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.