DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set2 and Suv39h2

DIOPT Version :9

Sequence 1:NP_572888.2 Gene:Set2 / 32301 FlyBaseID:FBgn0030486 Length:2362 Species:Drosophila melanogaster
Sequence 2:XP_038951911.1 Gene:Suv39h2 / 364785 RGDID:1306969 Length:511 Species:Rattus norvegicus


Alignment Length:243 Identity:83/243 - (34%)
Similarity:107/243 - (44%) Gaps:42/243 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1344 NFYRCARQVS-QENAEMQCDCFLTGDEEAQGHLSCGAGCI-----NRMLMI-------ECGPLCS 1395
            |.||.|..:: ...|...|.|.....|:.   ....||.:     ||.:.|       ||...|.
  Rat   274 NEYRPAPGITLNSEATFGCSCTNCFFEKC---CPAEAGVVLAYNKNRQIKIQPGTPIYECNSRCR 335

  Fly  1396 NGARCTNKRFQQHQCWPCRVFRTEKKGCGITAELL--IPPGEFIMEYVGEVIDSEEFERRQHLYS 1458
            .|..|.|:..|:...:...:||| ..|||...:.|  |....|:||||||||.|||.|||..|| 
  Rat   336 CGPDCPNRIVQKGTQYSLCIFRT-SNGCGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQLY- 398

  Fly  1459 KDRNRHYYFMAL---RGEAVIDATSKGNISRYINHSCDPNAETQKWTVNG---EL-RIGFFSVKP 1516
             |.....|...|   ..|..:||...||:|.::|||||||.:.....::.   .| ||..||.:.
  Rat   399 -DNKGITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFSVFIDNLDTRLPRIALFSTRT 462

  Fly  1517 IQPGEEITFDYQYLRYG--------------RDAQRCYCEAANCRGWI 1550
            |:.|||:|||||....|              |...:|.|.|..|||::
  Rat   463 IKAGEELTFDYQMKGSGELSSDSIDYSPARKRVRTQCKCGAETCRGYL 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Set2NP_572888.2 AWS 1358..1410 CDD:197795 15/63 (24%)
SET 1414..1533 CDD:214614 55/127 (43%)
PostSET 1535..1551 CDD:214703 6/16 (38%)
WW 2014..2043 CDD:278809
SRI 2270..2348 CDD:285448
Suv39h2XP_038951911.1 CD_SUV39H1_like 148..196 CDD:349289
SET_SUV39H2 268..510 CDD:380930 83/241 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352021
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.