DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set2 and EZH2

DIOPT Version :9

Sequence 1:NP_572888.2 Gene:Set2 / 32301 FlyBaseID:FBgn0030486 Length:2362 Species:Drosophila melanogaster
Sequence 2:XP_011514185.1 Gene:EZH2 / 2146 HGNCID:3527 Length:759 Species:Homo sapiens


Alignment Length:717 Identity:153/717 - (21%)
Similarity:235/717 - (32%) Gaps:239/717 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   886 EEQHAAKKGLSDNSPPSVLKAKEKAVSGFVECDAMFKAMDLANAQLRLDEKNKKKLKKVPTKVEA 950
            ||:...:|.|.|:......:...|..|     |.:|:|:..........|:.|:|.|:: |:.:.
Human   202 EEREEKQKDLEDHRDDKESRPPRKFPS-----DKIFEAISSMFPDKGTAEELKEKYKEL-TEQQL 260

  Fly   951 P--------PKVEPPTAVPVPGQKKSLSGKTSLRR-------------NTVYEDSPNL--ERNSS 992
            |        |.::.|.|..|..::...|..|...|             |..:..:||.  .:|:.
Human   261 PGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHRKCNYSFHATPNTYKRKNTE 325

  Fly   993 PSSDSAQ-----------ANTSAGKLKPSKVKKKINPRRSTICEAAKDLRSSSSSSTPTREVAAS 1046
            .:.|:..           |...|..|...::|..  |:|.......:...:||..||||..|.. 
Human   326 TALDNKPCGPQCYQHLEGAKEFAAALTAERIKTP--PKRPGGRRRGRLPNNSSRPSTPTINVLE- 387

  Fly  1047 SPVSTSSDSSSKRNGSKRTTSDLDGGSKLDQRRYTICEDRQPETAIPVPLTKRRFSMHPKASANP 1111
                           ||.|.||.:.|:               ||.                    
Human   388 ---------------SKDTDSDREAGT---------------ETG-------------------- 402

  Fly  1112 LHDTLLQTAGKKRGRKEGKESLSRQNSLDSSSSASQGAPKKKALKSAEILSAALLETESSESTS- 1175
                         |....||...:::...|||.|:........:|.         ..|..|:.. 
Human   403 -------------GENNDKEEEEKKDETSSSSEANSRCQTPIKMKP---------NIEPPENVEW 445

  Fly  1176 SGSKMSRWDVQTSPELEAANPFGDIAKFIEDGVNLLKRDKVDEDQRKEGQDEVKREADPEEDEFA 1240
            ||::.|.:.|......:   .|..||:.|  |....:                      :..||.
Human   446 SGAEASMFRVLIGTYYD---NFCAIARLI--GTKTCR----------------------QVYEFR 483

  Fly  1241 QRVANMETPATTPTPSPTQSNPEDSASTTTVLKELETGGGVRRSHRIKQKPQGPRASQGRGVASV 1305
            .:.:::..||           |.:...|....|        :|.||:                  
Human   484 VKESSIIAPA-----------PAEDVDTPPRKK--------KRKHRL------------------ 511

  Fly  1306 ALAPISMDEQLAELANIEAINEQFLRSEGLNTFQLLKENFYRC--ARQ---------VSQENAEM 1359
                     ..|....|:      |:.:|.:....   |:..|  .||         ::|...|.
Human   512 ---------WAAHCRKIQ------LKKDGSSNHVY---NYQPCDHPRQPCDSSCPCVIAQNFCEK 558

  Fly  1360 QCDCFLTGDEEAQGHL---SCGAGCINR-----MLMIECGP-LCSNGARCTNKRFQQHQCWPCRV 1415
            .|.|    ..|.|...   .|.|.|..:     :.:.||.| ||.......:...:...|..|.:
Human   559 FCQC----SSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSI 619

  Fly  1416 FRTEKK----------GCGITAELLIPPGEFIMEYVGEVIDSEEFERRQHLYSKDRNRHYYFMAL 1470
            .|..||          |.||..:..:...|||.||.||:|..:|.:||..:|  |:....:...|
Human   620 QRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVY--DKYMCSFLFNL 682

  Fly  1471 RGEAVIDATSKGNISRYINHSCDPNAETQKWTVNGELRIGFFSVKPIQPGEEITFDYQY-----L 1530
            ..:.|:|||.|||..|:.|||.:||...:...|||:.|||.|:.:.||.|||:.|||:|     |
Human   683 NNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADAL 747

  Fly  1531 RY 1532
            :|
Human   748 KY 749

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Set2NP_572888.2 AWS 1358..1410 CDD:197795 13/60 (22%)
SET 1414..1533 CDD:214614 51/134 (38%)
PostSET 1535..1551 CDD:214703
WW 2014..2043 CDD:278809
SRI 2270..2348 CDD:285448
EZH2XP_011514185.1 EZH2_WD-Binding 47..75 CDD:314486
SET 625..746 CDD:214614 47/122 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158010
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.