DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set2 and mes-4

DIOPT Version :9

Sequence 1:NP_572888.2 Gene:Set2 / 32301 FlyBaseID:FBgn0030486 Length:2362 Species:Drosophila melanogaster
Sequence 2:NP_506333.1 Gene:mes-4 / 179824 WormBaseID:WBGene00003222 Length:898 Species:Caenorhabditis elegans


Alignment Length:391 Identity:105/391 - (26%)
Similarity:154/391 - (39%) Gaps:91/391 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1345 FYRCARQVSQENAEMQCDCFLTGDEEAQGHLSCGAGCINRMLM--IECGPLCSNGARCTNKRFQQ 1407
            :|:|..::.:.:....|:|  .|.:... .|||      :.|.  .||.|.||....|.|::...
 Worm   477 YYKCEPKLEEYHNNEVCNC--EGADRCT-KLSC------QYLADDYECPPSCSKKGVCHNRQVSM 532

  Fly  1408 HQCWPCRVFRTEK--------KGCGITAELLIPPGEFIMEYVGEVIDSEEFERR--QHLYSKDRN 1462
            .       ..:||        ||.|:.|:..|...|:|.|||||:||..|.:||  ....|:|..
 Worm   533 G-------IVSEKIKLAATLCKGYGVFAKGQIEKDEYICEYVGEIIDKAEKKRRLDSVSISRDFQ 590

  Fly  1463 RHYYFMALRGEAVIDATSKGNISRYINHSCDPNAET------QKWTVNGEL---RIGFFSVKPIQ 1518
            .::|.|.|.....:||...|||||||||||||||.:      .|.|..|.|   |....:::.|.
 Worm   591 ANHYMMELHKGLTVDAARYGNISRYINHSCDPNAASFVTKVFVKKTKEGSLYDTRSYIRAIRTID 655

  Fly  1519 PGEEITFDYQYLRYGRDAQRCYCEAANCRGWIG----GEPD-SDEGEQLDEESDSDAEMDEEELE 1578
            .|:||||.|. :....:...|.|.|.||.|.:|    .:|: :|..|:..:::.|..:...:...
 Worm   656 DGDEITFSYN-MNNEENLPDCECGAENCMGTMGKAKREKPEVADSSEKAAKKNKSSKKKSVKNQN 719

  Fly  1579 AEPEEG------------QPRKSAKAKAKS------------------KLKAKLPLA-TG----- 1607
            .:.:|.            .|.|.:.:.|.|                  |..:..|:| ||     
 Worm   720 RKSQEAGKNGTASKKSEISPSKPSTSSASSTSFVQQASWPISQNKKNLKKNSNQPVADTGSTLST 784

  Fly  1608 -------RKRKEQTKPKDREYKAGRWLKPSATGSSS-----SAEKPPKKPKVNKFQAMLEDPDVV 1660
                   .|.:|...|.....:|.....|.|..|.|     .:|.||.|......|.:.|....:
 Worm   785 STELNFHEKPQELLSPVSSRSRAASSSTPRAQKSKSRRDDVESEAPPVKRATPSLQTIQETGKAI 849

  Fly  1661 E 1661
            |
 Worm   850 E 850

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Set2NP_572888.2 AWS 1358..1410 CDD:197795 14/53 (26%)
SET 1414..1533 CDD:214614 53/137 (39%)
PostSET 1535..1551 CDD:214703 6/15 (40%)
WW 2014..2043 CDD:278809
SRI 2270..2348 CDD:285448
mes-4NP_506333.1 PHD_SF 207..269 CDD:304600
SET 537..671 CDD:214614 53/134 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22884
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4489
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.