DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set2 and LOC103910708

DIOPT Version :9

Sequence 1:NP_572888.2 Gene:Set2 / 32301 FlyBaseID:FBgn0030486 Length:2362 Species:Drosophila melanogaster
Sequence 2:XP_017210664.2 Gene:LOC103910708 / 103910708 -ID:- Length:534 Species:Danio rerio


Alignment Length:377 Identity:85/377 - (22%)
Similarity:131/377 - (34%) Gaps:104/377 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   872 SVISKTTSNQPAPKEEQHAAKKGLSDNSPPSVLKAKEK---AV------SGFVECDAMFKAMDLA 927
            |.:||..|.:...|:.:....|.:......:||:|..|   ||      .|.:..|.:.|     
Zfish   132 SGMSKEVSMEVTAKKSEFGCGKEVLPKDCLAVLEAAFKDFQAVICKMQGPGAITGDCLTK----- 191

  Fly   928 NAQL----RLDEKNKKKLKKVPTKV--------EAPPKVEPPTAVPVPGQKKSLSGKTSLRRNTV 980
            |.||    .|:.....||.:.|..|        |...::|....|.|...|..||.:..|..|..
Zfish   192 NEQLLVLYYLEAVIMLKLVQRPGIVTHMTVEDWEGRSRIENGVCVAVKEHKVPLSHEQELWFNLY 256

  Fly   981 Y-EDSPNLERNSSPSSDSAQAN---TSAGK--LKPSKVKKKINPRRSTICEAAKDLRSSSSSSTP 1039
            : |..|.:.:.:....|.|..:   :|:|:  ..||...|:::.:.|.......|.:.:.     
Zfish   257 FNEVRPVMLQENHTDDDVAVDSFFVSSSGRSIYNPSNDLKRLHDKYSLPSVTCGDAQRAF----- 316

  Fly  1040 TREVAASSPVSTSSDSSSKRNGSKRTTSD-------LDG-GSKLDQR--RYTICEDRQPE-TAI- 1092
              |.||.|......:.:::||..:.|:||       ||. ..|..||  :.:.||.|..| ||. 
Zfish   317 --EAAAQSLSEVERNVAAERNYMRGTSSDPFLALSVLDQLAGKTPQRSSKASCCETRVDEQTAYK 379

  Fly  1093 ------------PVPLTKRRFSMHPKASANPLHDTLLQTAGKKRGRKEGKESLSRQNSLDSSSSA 1145
                        |.|...||..:.........:|         |.|.| :..|..|::|:..:. 
Zfish   380 TLEQFCPVTLEGPPPKRARRTELCGSEHERHCYD---------RWRSE-QLKLREQHALEHFAG- 433

  Fly  1146 SQGAPKKKALKSAEILSAALLETESSESTSSGSKMSRW-DVQ--TSPELEAA 1194
                                       ...|.||::|| |.|  ||...:||
Zfish   434 ---------------------------QQPSESKINRWMDKQGWTSNVPQAA 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Set2NP_572888.2 AWS 1358..1410 CDD:197795
SET 1414..1533 CDD:214614
PostSET 1535..1551 CDD:214703
WW 2014..2043 CDD:278809
SRI 2270..2348 CDD:285448
LOC103910708XP_017210664.2 SET 491..>531 CDD:214614
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593797
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.