DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1998 and CH25H

DIOPT Version :9

Sequence 1:NP_001285210.1 Gene:CG1998 / 32300 FlyBaseID:FBgn0030485 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_003947.1 Gene:CH25H / 9023 HGNCID:1907 Length:272 Species:Homo sapiens


Alignment Length:272 Identity:69/272 - (25%)
Similarity:113/272 - (41%) Gaps:54/272 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 ASGD-FWQSQWDKFIDSFGDEPMVLWVFGTTIFTMLVYWTVGTLYTF--MD-LTNRPACLRKYKI 190
            :||. |.|..|| .:.|:  |.::...|...||::..|  ||....|  :| |.:....||:|||
Human    14 SSGQLFLQPLWD-HLRSW--EALLQSPFFPVIFSITTY--VGFCLPFVVLDILCSWVPALRRYKI 73

  Fly   191 QPGTNEPVEVRRLLKVIWCVVCNQIFVGIPL---------AYASYRLMEIRGLSDIRDLPTFHWV 246
            .|..:.  ..::||..:...:...:....|:         |...:...|:        |...|.:
Human    74 HPDFSP--SAQQLLPCLGQTLYQHVMFVFPVTLLHWARSPALLPHEAPEL--------LLLLHHI 128

  Fly   247 CFELTVCILMEELGFYYSHRLLHHK--HIYKYIHKQHHEWTAPISVTAIYCHPIEHIFSNLLPPF 309
            .|    |:|:.::.|:..| |||||  .:|:..||.||:.::..::...|. .:..:||......
Human   129 LF----CLLLFDMEFFVWH-LLHHKVPWLYRTFHKVHHQNSSSFALATQYM-SVWELFSLGFFDM 187

  Fly   310 LGVFLMGSHVATAWLWFALAILSTLNAHSGYHLP----------FFPSPEAHDFHHLKFNNCFG- 363
            :.|.|:|.|..|...:..:.|..::..||||:.|          ::.....||.||..||..|. 
Human   188 MNVTLLGCHPLTTLTFHVVNIWLSVEDHSGYNFPWSTHRLVPFGWYGGVVHHDLHHSHFNCNFAP 252

  Fly   364 -------VLGVL 368
                   :||.|
Human   253 YFTHWDKILGTL 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1998NP_001285210.1 ERG3 <245..374 CDD:225546 39/144 (27%)
FA_hydroxylase 250..374 CDD:282034 38/139 (27%)
CH25HNP_003947.1 FA_hydroxylase 135..263 CDD:309300 34/129 (26%)
Histidine box-1 142..146 2/4 (50%)
Histidine box-2 157..161 2/3 (67%)
Histidine box-3 238..244 3/5 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3000
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.