DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1998 and SUR2

DIOPT Version :9

Sequence 1:NP_001285210.1 Gene:CG1998 / 32300 FlyBaseID:FBgn0030485 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_010583.1 Gene:SUR2 / 851891 SGDID:S000002705 Length:349 Species:Saccharomyces cerevisiae


Alignment Length:229 Identity:55/229 - (24%)
Similarity:98/229 - (42%) Gaps:41/229 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 MLVYWTVGTLYTFMDLTNRPACLRKYKIQPG-----TNEPVEVRRLLKVIWCVVCNQIFVGIPLA 222
            ::.||.:..::..:|..:   ...||:|.|.     .|:...:...|:||...:. |..||  |.
Yeast    57 VVAYWALSGIFHVIDTFH---LAEKYRIHPSEEVAKRNKASRMHVFLEVILQHII-QTIVG--LI 115

  Fly   223 YASYRLMEIRGLSD-----IR-DLP------------TFHWVCFELTVCILMEELGFYYSHRLLH 269
            :..:..:.:.|..:     :| |||            .:.....::....|..:...|:.|||:|
Yeast   116 FMHFEPIYMTGFEENAMWKLRADLPRIIPDAAIYYGYMYGMSALKIFAGFLFVDTWQYFLHRLMH 180

  Fly   270 -HKHIYKYIHKQHHEWTAPISVTAIYCHPIEHIFSNLLPPFLGVFLMGSHVA--TAWLWFALAIL 331
             :|.:||:.|..|||...|.:..|::.:|:|....:.|.  .|:.:..:|:.  ...:.|..|.:
Yeast   181 MNKTLYKWFHSVHHELYVPYAYGALFNNPVEGFLLDTLG--TGIAMTLTHLTHREQIILFTFATM 243

  Fly   332 STLNAHSGYHLP------FFPSPEA-HDFHHLKF 358
            .|::.|.||.||      .||:... ||.||.:|
Yeast   244 KTVDDHCGYALPLDPFQWLFPNNAVYHDIHHQQF 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1998NP_001285210.1 ERG3 <245..374 CDD:225546 35/124 (28%)
FA_hydroxylase 250..374 CDD:282034 35/119 (29%)
SUR2NP_010583.1 ERG3 40..337 CDD:225546 55/229 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3000
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.