DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1998 and SBH1

DIOPT Version :9

Sequence 1:NP_001285210.1 Gene:CG1998 / 32300 FlyBaseID:FBgn0030485 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_177122.2 Gene:SBH1 / 843300 AraportID:AT1G69640 Length:260 Species:Arabidopsis thaliana


Alignment Length:234 Identity:56/234 - (23%)
Similarity:103/234 - (44%) Gaps:30/234 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 TIFTMLVYWTVGTLYTFMDLTNRPACLRKYKIQPGTNEPVEVRRLL---KVIWCVVCNQIFVGIP 220
            |:..::|||....:|..:      :.|..|::.....|  |.:.|:   .|:..|:..|:.    
plant    14 TVAPIVVYWLYSGIYVAL------SSLESYRLHSKVEE--EEKNLVSKSSVVKGVLVQQVV---- 66

  Fly   221 LAYASYRLMEIRGL---SDIRDLPTFHWVCFELTVCILMEELGFYYSHRLLH-HKHIYKYIHKQH 281
            .|..:..|..:.|.   :|.....:|..:..:....:::.:...|:.||.:| :|.:||:||.||
plant    67 QAVVAILLFTVTGSDAEADKAQQFSFLVLARQFVTAMIVLDTWQYFMHRYMHQNKFLYKHIHSQH 131

  Fly   282 HEWTAPISVTAIYCHPIEHIFSNLLPPFLGVFLMGSHVATAWLWFALAILSTLNAHSG------- 339
            |....|.:..|:|.||:|.:..:.:...|...:.|....|:..:|:.|.:.|::.|.|       
plant   132 HRLIVPYAYGALYNHPVEGLLLDTIGGALSFLVSGMSPRTSIFFFSFATIKTVDDHCGLWLPGNL 196

  Fly   340 YHLPFFPSPEAHDFHH----LKFNNCFGVLGVLDRLHGT 374
            :|:.|..:...||.||    .|:|.......:.||:.||
plant   197 FHMVFKNNSAYHDIHHQLYGTKYNFSQPFFVMWDRILGT 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1998NP_001285210.1 ERG3 <245..374 CDD:225546 36/140 (26%)
FA_hydroxylase 250..374 CDD:282034 36/135 (27%)
SBH1NP_177122.2 FA_hydroxylase 99..235 CDD:397991 36/135 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3000
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1321777at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.