DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1998 and SBH2

DIOPT Version :9

Sequence 1:NP_001285210.1 Gene:CG1998 / 32300 FlyBaseID:FBgn0030485 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_563944.1 Gene:SBH2 / 837990 AraportID:AT1G14290 Length:259 Species:Arabidopsis thaliana


Alignment Length:235 Identity:66/235 - (28%)
Similarity:104/235 - (44%) Gaps:32/235 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 TIFTMLVYWTVGTLYTFMDLTNRPACLRKYKIQPGTNEPVEVRRLLK---VIWCVVCNQIFVGIP 220
            |...:||||....:|..:      ..|.||::....:|  :.:.|:.   |:..|:..|....| 
plant    13 TFVPILVYWVYSGMYICL------GSLDKYRLHSKIDE--DEKNLVSKSAVVKGVLLQQTLQAI- 68

  Fly   221 LAYASYRLMEIRGLSDIRDLPTFHW----VCFELTVCILMEELGFYYSHRLLH-HKHIYKYIHKQ 280
               .|..|.:|.| ||.....|..:    :..:..:.:|:.:...|:.||.:| :|.:||:||.|
plant    69 ---ISVILFKITG-SDADAATTQQFSILLLARQFIIAMLVIDTWQYFIHRYMHLNKFLYKHIHSQ 129

  Fly   281 HHEWTAPISVTAIYCHPIEHIFSNLLPPFLGVFLMGSHVATAWLWFALAILSTLNAHSGYHLP-- 343
            ||....|.|..|:|.||:|.:..:.:...|.....|....||..:|:.|.:.|::.|.|..||  
plant   130 HHRLIVPYSYGALYNHPLEGLLLDTIGGALSFLFSGMSPRTAIFFFSFATIKTVDDHCGLWLPGN 194

  Fly   344 ----FFPSPEA-HDFHH----LKFNNCFGVLGVLDRLHGT 374
                ||.:..| ||.||    .|:|.......:.||:.||
plant   195 PFHIFFSNNSAYHDVHHQLYGTKYNFSQPFFVMWDRILGT 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1998NP_001285210.1 ERG3 <245..374 CDD:225546 42/144 (29%)
FA_hydroxylase 250..374 CDD:282034 42/135 (31%)
SBH2NP_563944.1 FA_hydroxylase 98..234 CDD:397991 42/135 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3000
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1321777at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.