DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1998 and SMO1-2

DIOPT Version :9

Sequence 1:NP_001285210.1 Gene:CG1998 / 32300 FlyBaseID:FBgn0030485 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_567670.1 Gene:SMO1-2 / 828374 AraportID:AT4G22756 Length:299 Species:Arabidopsis thaliana


Alignment Length:304 Identity:95/304 - (31%)
Similarity:142/304 - (46%) Gaps:46/304 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 AAFILFRNVLTWHLQSFWGASGDFWQSQWDKFIDSFGDEPMVLWVFGTTIFTM----LVYWTVGT 171
            |:..|.|| ||| |::.|   .|:..::.|.::....    :|::|  .||::    ||:  :.:
plant    10 ASIALSRN-LTW-LETLW---FDYSATKSDYYLYCHN----ILFLF--LIFSLVPLPLVF--IES 61

  Fly   172 LYTFMDLTNRPACLRKYKIQPGTNEPVEVRRLLKVIWCVVCNQIFVGIPL---AYASYRLMEIR- 232
            ..:..||.||      |||||....  ....:.|....|:...|.|..||   :|.|.:::||| 
plant    62 SQSTSDLFNR------YKIQPKVKN--SFSSMFKCYKDVMKMFILVVGPLQLVSYPSIQMIEIRS 118

  Fly   233 GLSDIRDLPTFHWVCFELTVCILMEELGFYYSHRLLHHKHIYKYIHKQHHEWTAPISVTAIYCHP 297
            ||    .||:...:..:|.|..|:|:...|:.||..|.|..|:..|..|||:||||...|.|.|.
plant   119 GL----PLPSCMEIVAQLVVYFLVEDYTNYWVHRFFHCKWGYEKFHHIHHEYTAPIGYAAPYAHW 179

  Fly   298 IEHIFSNLLPPFLGVFLMGSHVATAWLWFALAILSTLNAHSGY--------HLPFFPSPEAHDFH 354
            .|.:... :|.|||..:...|:.|.|||.||..:..:..||||        ::||:...|.||:|
plant   180 AEVLLLG-IPTFLGPAIAPGHMITFWLWIALRQIEAIETHSGYDFPWSLTKYIPFYGGAEYHDYH 243

  Fly   355 HL----KFNNCFGVLGVLDRLHGTDSLFRATKSYARHIMMLSFK 394
            |.    ..:|...|....|.::|||..:|..|...:.:...|.|
plant   244 HYVGGQSQSNFASVFTYCDYIYGTDKGYRFQKKLLQQMKEKSKK 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1998NP_001285210.1 ERG3 <245..374 CDD:225546 47/140 (34%)
FA_hydroxylase 250..374 CDD:282034 47/135 (35%)
SMO1-2NP_567670.1 FA_hydroxylase 132..267 CDD:397991 47/135 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 99 1.000 Domainoid score I2371
eggNOG 1 0.900 - - E1_COG3000
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 135 1.000 Inparanoid score I1831
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1069
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11863
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.