DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1998 and SMO1-1

DIOPT Version :9

Sequence 1:NP_001285210.1 Gene:CG1998 / 32300 FlyBaseID:FBgn0030485 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_192948.1 Gene:SMO1-1 / 826819 AraportID:AT4G12110 Length:298 Species:Arabidopsis thaliana


Alignment Length:301 Identity:92/301 - (30%)
Similarity:136/301 - (45%) Gaps:40/301 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 AAFILFRNVLTWHLQSFWGASGDFWQSQWDKFIDSFGDEPMVLWVFGTTIFTMLVYWTVGTLYTF 175
            |:..|.||:.  .|::.|   .|:..::.|.::           .....:|..||:..|.....|
plant    10 ASIALGRNLT--RLETLW---FDYSATKSDYYL-----------YCHNILFLFLVFSLVPLPLVF 58

  Fly   176 MDLTNRPACL-RKYKIQPGTNEPVEVRRLLKVIWCVVCNQIFVGIPL---AYASYRLMEIR-GLS 235
            ::|....:.| .:|||||..|  ..:..:.|....|:...|.|..||   :|.|.:::||| || 
plant    59 VELARSASGLFNRYKIQPKVN--YSLSDMFKCYKDVMTMFILVVGPLQLVSYPSIQMIEIRSGL- 120

  Fly   236 DIRDLPTFHWVCFELTVCILMEELGFYYSHRLLHHKHIYKYIHKQHHEWTAPISVTAIYCHPIEH 300
               .|||...:..:|.|..|:|:...|:.||..|.|..|..||:.|||:||||...|.|.|..|.
plant   121 ---PLPTITEMLSQLVVYFLIEDYTNYWVHRFFHSKWGYDKIHRVHHEYTAPIGYAAPYAHWAEV 182

  Fly   301 IFSNLLPPFLGVFLMGSHVATAWLWFALAILSTLNAHSGY--------HLPFFPSPEAHDFHHL- 356
            :... :|.|:|..:...|:.|.|||.||..:..:..||||        ::||:...|.||:||. 
plant   183 LLLG-IPTFMGPAIAPGHMITFWLWIALRQMEAIETHSGYDFPWSPTKYIPFYGGAEYHDYHHYV 246

  Fly   357 ---KFNNCFGVLGVLDRLHGTDSLFRATKSYARHIMMLSFK 394
               ..:|...|....|.::|||..:|..|.....|...|.|
plant   247 GGQSQSNFASVFTYCDYIYGTDKGYRFQKKLLEQIKESSKK 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1998NP_001285210.1 ERG3 <245..374 CDD:225546 47/140 (34%)
FA_hydroxylase 250..374 CDD:282034 47/135 (35%)
SMO1-1NP_192948.1 FA_hydroxylase 132..267 CDD:397991 47/135 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 99 1.000 Domainoid score I2371
eggNOG 1 0.900 - - E1_COG3000
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 135 1.000 Inparanoid score I1831
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1069
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11863
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.