DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1998 and ch25hl1.2

DIOPT Version :9

Sequence 1:NP_001285210.1 Gene:CG1998 / 32300 FlyBaseID:FBgn0030485 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001076393.1 Gene:ch25hl1.2 / 798384 ZFINID:ZDB-GENE-050419-90 Length:276 Species:Danio rerio


Alignment Length:283 Identity:73/283 - (25%)
Similarity:116/283 - (40%) Gaps:51/283 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 WQSQWDKFIDSFGDEPMVL---WVF-------------GTTIFTMLVYWTVGTLYTFMDLTNR-- 181
            :|:.||     ||.:..||   |.:             ...:.|:..|:.:...|...|:..|  
Zfish     7 FQTIWD-----FGTKDSVLQPIWDYVRLNHSETLRSPLFPVVLTVSSYFVLVLPYLSCDILGRKW 66

  Fly   182 PACLRKYKIQPGTNEPVEVRRLLKVIWCVVCNQIFVGIPLAYASYRLMEIRGLSDIRDLPTFHWV 246
            ||..| |||||  ::......||......:.|.|.:.||.|.|.:.......|.:  ..||...:
Zfish    67 PAIYR-YKIQP--DKLPTTAMLLHCSGVTLYNHILLVIPAAVAQWMWRPPIPLPE--QAPTLLEL 126

  Fly   247 CFELTVCILMEELGFYYSHRLLHHKHIYKYI--HKQHHEWTAPISVTAIYC----HPIEHIFSNL 305
            ...:|..:|:.:|.::..| .||||..:.|:  |..||.::||.:: |..|    ..:...|...
Zfish   127 VGGVTGNLLLFDLQYFIWH-FLHHKIRWLYVTFHAIHHNYSAPFAL-ATQCLGGWELVTVGFWTT 189

  Fly   306 LPPFLGVFLMGSHVATAWLWFALAILSTLNAHSGYHLPF----------FPSPEAHDFHHLKFNN 360
            |.|    .|:..|:.|.|::..:.:..::..|.||..|:          :..|..||.||.|.|.
Zfish   190 LNP----VLLRCHLLTTWMFMVVHVYVSVEDHCGYDFPWSTSRLIPFGVYGGPSKHDVHHQKPNT 250

  Fly   361 CFGV-LGVLDRLHGTDSLFRATK 382
            .|.. ....|::.||.:.||.:|
Zfish   251 NFAPHFSHWDKMFGTHADFRFSK 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1998NP_001285210.1 ERG3 <245..374 CDD:225546 36/145 (25%)
FA_hydroxylase 250..374 CDD:282034 36/140 (26%)
ch25hl1.2NP_001076393.1 FA_hydroxylase 134..265 CDD:309300 35/136 (26%)
Histidine box-1. /evidence=ECO:0000255 144..148 1/4 (25%)
Histidine box-2. /evidence=ECO:0000255 159..163 1/3 (33%)
Histidine box-3. /evidence=ECO:0000255 240..246 3/5 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3000
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.