DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1998 and msmo1

DIOPT Version :9

Sequence 1:NP_001285210.1 Gene:CG1998 / 32300 FlyBaseID:FBgn0030485 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001072809.1 Gene:msmo1 / 780270 XenbaseID:XB-GENE-960872 Length:294 Species:Xenopus tropicalis


Alignment Length:278 Identity:82/278 - (29%)
Similarity:134/278 - (48%) Gaps:42/278 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 WDKFIDSFGDEPMVLWVFGTTIFTMLVYWTV---GTLYTFMDLTNRPACLRKYKIQPGTNEPVEV 200
            |...||::....:..|  |:.:...|:|:..   |.::.|:..      ::|||||....|..|.
 Frog    37 WTYMIDNYTKFQIATW--GSLLVHELIYFLFCLPGFIFQFLPF------MQKYKIQQDKPETWES 93

  Fly   201 R-RLLKVIWCVVCNQIFVGIPLAYASYRLMEIRGLS-DIRDLPTFHWVCFELTVCILMEELGFYY 263
            : |..|::   :.|...:..||.:.::...|...:. |...:|.::.:|.:...|.::|:...|:
 Frog    94 QWRCFKML---LFNHFCIQFPLIFGTFHFTEYFNIPYDWESMPRWYILCAQCFGCAVIEDAWHYF 155

  Fly   264 SHRLLHHKHIYKYIHKQHHEWTAPISVTAIYCHPIEHI-----FSNLLPPFLGVFLMGSHVATAW 323
            .||:||||.|||||||.|||:|:|..:.|.|.||:|.:     |      |:|:.:..:||...|
 Frog   156 LHRILHHKRIYKYIHKVHHEFTSPFGMQAEYAHPLETLILGAGF------FIGIMVFCNHVVLMW 214

  Fly   324 LWFALAILSTLNAHSGY-------HL-PFFPSPEAHDFHHLKF-NNCFGVLGVLDRLHGTDSLFR 379
            .|..:.:|.|::.||||       || ||:.....|||||:.| .|........|::..|||   
 Frog   215 AWVMVRLLETIDVHSGYDIPLNPLHLFPFYAGARFHDFHHMNFVGNYASTFTWWDKILSTDS--- 276

  Fly   380 ATKSYARHIMMLSFKPPR 397
               .|..::..:..||.:
 Frog   277 ---QYNNYMDKVKAKPEK 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1998NP_001285210.1 ERG3 <245..374 CDD:225546 52/142 (37%)
FA_hydroxylase 250..374 CDD:282034 51/137 (37%)
msmo1NP_001072809.1 ERG3 62..274 CDD:225546 70/226 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R751
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.