DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1998 and Faxdc2

DIOPT Version :9

Sequence 1:NP_001285210.1 Gene:CG1998 / 32300 FlyBaseID:FBgn0030485 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_017453123.1 Gene:Faxdc2 / 691221 RGDID:1586284 Length:416 Species:Rattus norvegicus


Alignment Length:324 Identity:138/324 - (42%)
Similarity:200/324 - (61%) Gaps:1/324 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 LQNWDDARTADVWLSSLHSVIFIITCALAAFILFRNVLTWHLQSFWGASGDFWQSQWDKFIDSFG 147
            |.|...|....:| .|:.....|:...|.....|.|.:||:.|.||||||||||::|:..:.:|.
  Rat    80 LGNNPSAEKGHIW-DSMRRTALILGLGLLLLAAFWNSITWYPQRFWGASGDFWQTRWETLLSTFE 143

  Fly   148 DEPMVLWVFGTTIFTMLVYWTVGTLYTFMDLTNRPACLRKYKIQPGTNEPVEVRRLLKVIWCVVC 212
            ....:|::.|..:...|.:|....|...:|.|.:|..:.:|:||...||||:..:|.:.|..|:.
  Rat   144 GNEWILYIIGVVLVPGLCFWGFNGLLLMVDRTGKPTFISRYRIQLDKNEPVDPVKLRQSIRTVIF 208

  Fly   213 NQIFVGIPLAYASYRLMEIRGLSDIRDLPTFHWVCFELTVCILMEELGFYYSHRLLHHKHIYKYI 277
            ||..:..|:....|..::..|....|:||||||:..||.:..|::|:.|||||||.||..::|.:
  Rat   209 NQSVISFPMLVILYPFLKWTGDPCCRELPTFHWILVELVLFTLVQEILFYYSHRLFHHPKLFKKV 273

  Fly   278 HKQHHEWTAPISVTAIYCHPIEHIFSNLLPPFLGVFLMGSHVATAWLWFALAILSTLNAHSGYHL 342
            ||:|||||.||.:.:||..||||:.||:||..:|...||||:::..:|.:|.::.:...|.||||
  Rat   274 HKKHHEWTTPIGLISIYADPIEHVVSNMLPVMVGPLAMGSHLSSITVWLSLVLIVSSITHCGYHL 338

  Fly   343 PFFPSPEAHDFHHLKFNNCFGVLGVLDRLHGTDSLFRATKSYARHIMMLSFKPPRDAFPDPTMK 406
            ||.||||.||:||||||.|:|||||:|.|||||.:|:.||:|.||:::|.|.|..::.|||..|
  Rat   339 PFLPSPEFHDYHHLKFNQCYGVLGVMDHLHGTDVMFKQTKAYERHVILLGFTPLSESIPDPPKK 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1998NP_001285210.1 ERG3 <245..374 CDD:225546 69/128 (54%)
FA_hydroxylase 250..374 CDD:282034 67/123 (54%)
Faxdc2XP_017453123.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 168 1.000 Domainoid score I3737
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41863
Inparanoid 1 1.050 310 1.000 Inparanoid score I2526
OMA 1 1.010 - - QHG48620
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002076
OrthoInspector 1 1.000 - - oto96528
orthoMCL 1 0.900 - - OOG6_105513
Panther 1 1.100 - - LDO PTHR11863
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3944
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.970

Return to query results.
Submit another query.