DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1998 and Msmo1

DIOPT Version :9

Sequence 1:NP_001285210.1 Gene:CG1998 / 32300 FlyBaseID:FBgn0030485 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_079712.1 Gene:Msmo1 / 66234 MGIID:1913484 Length:293 Species:Mus musculus


Alignment Length:265 Identity:84/265 - (31%)
Similarity:128/265 - (48%) Gaps:36/265 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 WQSQWDKFIDSFGDEPMVLWVFGTTIFTMLVYWTV---GTLYTFMDLTNRPACLRKYKIQPGTNE 196
            :::.|...:|::....:..|  |:.|....:|:..   |.|:.|:..      :||||||....|
Mouse    33 FKNAWVYMLDNYTKFQIATW--GSLIVHEAIYFLFSLPGFLFQFIPY------MRKYKIQKDKPE 89

  Fly   197 PVEVR-RLLKVIWCVVCNQIFVGIPLAYASYRLMEIRGLS-DIRDLPTFHWVCFELTVCILMEEL 259
            ..|.: :.||.|   :.|..|:.:||...:|...|...:. |...:|.::........|.::|:.
Mouse    90 TFEGQWKCLKKI---LFNHFFIQLPLICGTYYFTEFFNIPYDWERMPRWYLTLARCLGCAVIEDT 151

  Fly   260 GFYYSHRLLHHKHIYKYIHKQHHEWTAPISVTAIYCHPIEHI-----FSNLLPPFLGVFLMGSHV 319
            ..|:.|||||||.|||||||.|||:.||..:.|.|.||:|.:     |      |:|:.|:..||
Mouse   152 WHYFLHRLLHHKRIYKYIHKVHHEFQAPFGIEAEYAHPLETLILGTGF------FIGIVLLCDHV 210

  Fly   320 ATAWLWFALAILSTLNAHSGYHL--------PFFPSPEAHDFHHLKF-NNCFGVLGVLDRLHGTD 375
            ...|.|..:.:|.|::.||||.:        ||:.....|||||:.| .|........|:|.|||
Mouse   211 ILLWAWVTIRLLETIDVHSGYDIPLNPLNLVPFYTGARHHDFHHMNFIGNYASTFTWWDKLFGTD 275

  Fly   376 SLFRA 380
            :.:.|
Mouse   276 AQYHA 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1998NP_001285210.1 ERG3 <245..374 CDD:225546 52/142 (37%)
FA_hydroxylase 250..374 CDD:282034 52/137 (38%)
Msmo1NP_079712.1 FA_hydroxylase 143..274 CDD:397991 52/136 (38%)
Histidine box-1 157..161 3/3 (100%)
Histidine box-2 170..174 2/3 (67%)
Histidine box-3 249..255 4/5 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3000
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R751
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.