DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1998 and SC5D

DIOPT Version :9

Sequence 1:NP_001285210.1 Gene:CG1998 / 32300 FlyBaseID:FBgn0030485 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001020127.1 Gene:SC5D / 6309 HGNCID:10547 Length:299 Species:Homo sapiens


Alignment Length:243 Identity:68/243 - (27%)
Similarity:105/243 - (43%) Gaps:36/243 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 TTIFTMLVYWTVGTL-YTFM---DLTNRPACLRKYKIQPGTNEPVEVRRLLKVIWCVVCNQIFVG 218
            |.:...::|:...|| |.|:   .|...|..|:.           :|||.:|     ...|....
Human    38 TNVGAYILYFFCATLSYYFVFDHALMKHPQFLKN-----------QVRREIK-----FTVQALPW 86

  Fly   219 IPLAYASYRLMEIRGLSDIR-DLPTFHWVCFELTVCIL----MEELGFYYSHRLLHHKHIYKYIH 278
            |.:...:..|:||||.|.:. ||..|.:..|||.|.|:    ..::..|:.||.|||:.:||.:|
Human    87 ISILTVALFLLEIRGYSKLHDDLGEFPYGLFELVVSIISFLFFTDMFIYWIHRGLHHRLVYKRLH 151

  Fly   279 KQHHEWTAPISVTAIYCHPIEHIFSNLLPPFLGVFLMGSHVATAWLWFALAILSTLNAHSG-YHL 342
            |.||.|..|....:...|||:. |...||..:..|:...|.......:.|..:.|::.|.| :.:
Human   152 KPHHIWKIPTPFASHAFHPIDG-FLQSLPYHIYPFIFPLHKVVYLSLYILVNIWTISIHDGDFRV 215

  Fly   343 -----PFFPSPEAHDFHHLKFNNCFGVLGVL-DRLHGTDSLFRATKSY 384
                 ||......|..||:.|:..:|....| ||:.|:   |:...|:
Human   216 PQILQPFINGSAHHTDHHMFFDYNYGQYFTLWDRIGGS---FKNPSSF 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1998NP_001285210.1 ERG3 <245..374 CDD:225546 41/139 (29%)
FA_hydroxylase 250..374 CDD:282034 39/134 (29%)
SC5DNP_001020127.1 ERG3 34..257 CDD:225546 67/238 (28%)
Histidine box-1 138..143 3/4 (75%)
Histidine box-2 151..155 2/3 (67%)
Histidine box-3 228..233 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 274..299
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3000
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.