DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1998 and MSMO1

DIOPT Version :9

Sequence 1:NP_001285210.1 Gene:CG1998 / 32300 FlyBaseID:FBgn0030485 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_006736.1 Gene:MSMO1 / 6307 HGNCID:10545 Length:293 Species:Homo sapiens


Alignment Length:262 Identity:81/262 - (30%)
Similarity:131/262 - (50%) Gaps:30/262 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 WQSQWDKFIDSFGDEPMVLWVFGTTIFTMLVYWTV---GTLYTFMDLTNRPACLRKYKIQPGTNE 196
            :::.|:..::::....:..|  |:.|....:|:..   |.|:.|:..      ::|||||....|
Human    33 FKNAWNYMLNNYTKFQIATW--GSLIVHEALYFLFCLPGFLFQFIPY------MKKYKIQKDKPE 89

  Fly   197 PVEVR-RLLKVIWCVVCNQIFVGIPLAYASYRLMEIRGLS-DIRDLPTFHWVCFELTVCILMEEL 259
            ..|.: :..||:   :.|...:.:||...:|...|...:. |...:|.::::......|.::|:.
Human    90 TWENQWKCFKVL---LFNHFCIQLPLICGTYYFTEYFNIPYDWERMPRWYFLLARCFGCAVIEDT 151

  Fly   260 GFYYSHRLLHHKHIYKYIHKQHHEWTAPISVTAIYCHPIEHIFSNLLPP--FLGVFLMGSHVATA 322
            ..|:.|||||||.|||||||.|||:.||..:.|.|.||:|.:   :|..  |:|:.|:..||...
Human   152 WHYFLHRLLHHKRIYKYIHKVHHEFQAPFGMEAEYAHPLETL---ILGTGFFIGIVLLCDHVILL 213

  Fly   323 WLWFALAILSTLNAHSGYH--------LPFFPSPEAHDFHHLKF-NNCFGVLGVLDRLHGTDSLF 378
            |.|..:.:|.|::.||||.        :||:.....|||||:.| .|........||:.||||.:
Human   214 WAWVTIRLLETIDVHSGYDIPLNPLNLIPFYAGSRHHDFHHMNFIGNYASTFTWWDRIFGTDSQY 278

  Fly   379 RA 380
            .|
Human   279 NA 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1998NP_001285210.1 ERG3 <245..374 CDD:225546 52/139 (37%)
FA_hydroxylase 250..374 CDD:282034 52/134 (39%)
MSMO1NP_006736.1 ERG3 60..274 CDD:225546 72/225 (32%)
Histidine box-1 157..161 3/3 (100%)
Histidine box-2 170..174 2/3 (67%)
Histidine box-3 249..255 4/5 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3000
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.