DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1998 and msmo1

DIOPT Version :9

Sequence 1:NP_001285210.1 Gene:CG1998 / 32300 FlyBaseID:FBgn0030485 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_998518.1 Gene:msmo1 / 406662 ZFINID:ZDB-GENE-040426-2670 Length:291 Species:Danio rerio


Alignment Length:267 Identity:80/267 - (29%)
Similarity:129/267 - (48%) Gaps:36/267 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 WDKFIDSFGDEPMVLWVFGTTIFTMLVYWTV---GTLYTFMDLTNRPACLRKYKIQPGTNEPVEV 200
            |:..:.::....:..|  |:.|...|:|:..   |.::.|:..      ::||||||  ::|...
Zfish    37 WNHMLQNYTKFQIATW--GSLIVHELIYFLFCLPGFIFQFLPF------MQKYKIQP--DKPETW 91

  Fly   201 RRLLKVIWCVVCNQIFVGIPLAYASYRLMEIRGLS-DIRDLPTFHWVCFELTVCILMEELGFYYS 264
            .:..|....::.|...:.:||...:|...|...:. |...:|.:.::..:...|.::|:...|:.
Zfish    92 EKQWKCFKMLLFNHFCIQLPLICGTYYFTEFFSIPYDWDTMPRWPFLLAQCFGCAVIEDTWHYFL 156

  Fly   265 HRLLHHKHIYKYIHKQHHEWTAPISVTAIYCHPIEHI-----FSNLLPPFLGVFLMGSHVATAWL 324
            ||.|||:.|||||||.||::|:|..:.|.|.||:|.:     |      |:|..:..:|:...|.
Zfish   157 HRALHHRRIYKYIHKVHHDFTSPFGMQAEYAHPLETLILGAGF------FIGTMVFCNHMILLWA 215

  Fly   325 WFALAILSTLNAHSGY-------HL-PFFPSPEAHDFHHLKFNNCFG-VLGVLDRLHGTDSLFRA 380
            |....:|.|::.||||       || ||:.....|||||:.|...:| .....|||..|||.|  
Zfish   216 WVTFRLLETIDVHSGYDIPLNPLHLIPFYAGARFHDFHHMNFVGNYGSTFTWWDRLFDTDSQF-- 278

  Fly   381 TKSYARH 387
            .|.|:.|
Zfish   279 NKHYSHH 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1998NP_001285210.1 ERG3 <245..374 CDD:225546 50/142 (35%)
FA_hydroxylase 250..374 CDD:282034 50/137 (36%)
msmo1NP_998518.1 ERG3 60..274 CDD:225546 69/227 (30%)
FA_hydroxylase 145..274 CDD:282034 50/134 (37%)
Histidine box-1. /evidence=ECO:0000250 157..161 2/3 (67%)
Histidine box-2. /evidence=ECO:0000250 170..174 2/3 (67%)
Histidine box-3. /evidence=ECO:0000250 249..255 4/5 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R751
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.