DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1998 and fa2h

DIOPT Version :9

Sequence 1:NP_001285210.1 Gene:CG1998 / 32300 FlyBaseID:FBgn0030485 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_610279.3 Gene:fa2h / 35670 FlyBaseID:FBgn0050502 Length:355 Species:Drosophila melanogaster


Alignment Length:247 Identity:51/247 - (20%)
Similarity:87/247 - (35%) Gaps:72/247 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 KAGLPPVYLNLNDNAKEQTPLP-GSPLQNWDD-----ARTADVWLSSLHSVIFIITCALAAFILF 116
            ||.||.: .|:.|...|....| ..||:.:|.     ......||..|..:..|:.||:..|.  
  Fly   124 KAMLPQI-ANITDCYDEWVHKPVDRPLRLFDPWYLEMCTKTPWWLVPLFWIPVIVKCAVEEFT-- 185

  Fly   117 RNVLTWHLQSFWGASGDFWQ--SQWDKFIDSFGDEPMVLWVFGTTIFTMLVYWTVGTLYTF---M 176
                            ..||  :|...|...|        :||..:::.|.|    ||:.:   :
  Fly   186 ----------------TAWQDSNQLAVFSGYF--------LFGVLLWSFLEY----TLHRWVFHV 222

  Fly   177 DLTNRPA---CLRKYKIQPGTNE--PVEVRRLL--KVIWCVVCNQIFVGIPLAYASYRLMEIRGL 234
            .|:|:..   |...:.|. |.:.  |.:..||:  .:...|:...|:..:....:..|::....|
  Fly   223 KLSNKSGSWLCTFHFMIH-GLHHKVPFDPMRLVFPPLPGAVLAAVIYTPLSFVLSHPRVILSGAL 286

  Fly   235 SDIRDLPTFHWVCFELTVCILMEELGFYYSH----RLLHHKHIYKYIHKQHH 282
            :.        ::|:::.         .||.|    .|....|:.:| |..||
  Fly   287 AG--------YLCYDMM---------HYYLHYGNPSLWAFVHMKRY-HHHHH 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1998NP_001285210.1 ERG3 <245..374 CDD:225546 10/42 (24%)
FA_hydroxylase 250..374 CDD:282034 9/37 (24%)
fa2hNP_610279.3 Cyt-b5 6..73 CDD:278597
FA_hydroxylase 117..341 CDD:294712 51/247 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.