DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1998 and ch25hl1.1

DIOPT Version :9

Sequence 1:NP_001285210.1 Gene:CG1998 / 32300 FlyBaseID:FBgn0030485 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001017865.1 Gene:ch25hl1.1 / 336673 ZFINID:ZDB-GENE-030131-8617 Length:282 Species:Danio rerio


Alignment Length:270 Identity:66/270 - (24%)
Similarity:111/270 - (41%) Gaps:29/270 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 ASGDFWQSQWDKFIDSFGDEPMVLWVFGTTIFTMLVYWTVGTLYTFMDLTNRPACLRKYKIQPGT 194
            ||....|..||..:  .....::...|...:.....|......:..:|:....|.|.|||||...
Zfish    16 ASDRLLQPLWDYLL--LRHYTLISSPFFPVLLAFSSYIIFSVPFAVLDVLGEKAPLFKYKIQKDR 78

  Fly   195 NEPVEVRRLLKVIWCVVCNQIFVGIPLAYASYRLMEIRGLSDIRDLPTFHWVCFELTVCILMEEL 259
            :..|.:  :|:.:|..|.|.:...:|....:..:|.:..|..:  .||. |..|...:..|:...
Zfish    79 SPTVGM--MLRTLWTAVYNHLVFVLPAVLITNMVMPMPPLPTV--APTV-WEMFSGGLGALLVFD 138

  Fly   260 GFYYSHRLLHHK--HIYKYIHKQHHEWTAPISVTAIYCHPIE----HIFSNLLPPFLGVFLMGSH 318
            ..|:...::|||  |:|:::|..||::.:|.|.:..:...:|    ..:||:.|     .|:..|
Zfish   139 TQYFLWHMVHHKNPHLYRWVHAIHHDYISPFSWSTQHLSGVELMTVGFWSNIDP-----ILLKCH 198

  Fly   319 VATAWLWFALAILSTLNAHSGYHLPFFP----------SPEAHDFHHLKFNNCFG-VLGVLDRLH 372
            ..|.|.....:|..::..|.||.|||.|          ...|||.||.|.::.|. .....|::.
Zfish   199 PLTVWTLTVYSIWMSVEDHIGYDLPFSPGHLVPFGLLGGAMAHDMHHQKPSSNFAPFFSHWDKIF 263

  Fly   373 GTDSLFRATK 382
            ||....:.|:
Zfish   264 GTAITVKLTQ 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1998NP_001285210.1 ERG3 <245..374 CDD:225546 38/145 (26%)
FA_hydroxylase 250..374 CDD:282034 36/140 (26%)
ch25hl1.1NP_001017865.1 ERG3 28..267 CDD:225546 60/250 (24%)
FA_hydroxylase 131..265 CDD:282034 36/138 (26%)
Histidine box-1 144..148 0/3 (0%)
Histidine box-2 159..163 1/3 (33%)
Histidine box-3 240..246 4/5 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3000
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.