DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1998 and CG11162

DIOPT Version :9

Sequence 1:NP_001285210.1 Gene:CG1998 / 32300 FlyBaseID:FBgn0030485 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_572910.1 Gene:CG11162 / 32325 FlyBaseID:FBgn0030509 Length:278 Species:Drosophila melanogaster


Alignment Length:255 Identity:118/255 - (46%)
Similarity:170/255 - (66%) Gaps:5/255 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 WGASGDFWQSQWDKFIDSFGDEPMVLWVFGTTIFTMLVYWTVGTLYTFMDLTNRPACLRKYKIQP 192
            |..|||:.|.:|...:|:.|:|...|||.|:|:...:|||....::|.||:||||..||||||||
  Fly     8 WTQSGDYLQDKWTLLLDTVGEESWRLWVVGSTVVIFIVYWLYAGIFTLMDITNRPRFLRKYKIQP 72

  Fly   193 GTNEPVEVRRLLKVIWCVVCNQIFVGIPLAYASYRLM-EIRGLSDIRDLPTFHWVCFELTVCILM 256
            |.||||.:.:|...:..|:.|...|...:::..|..: :.....|||.||||.....:|.|.:::
  Fly    73 GQNEPVNLAKLWHAVKVVLFNLTVVNFLVSWVVYEFVYKSENSQDIRVLPTFKRSLRDLVVFVVL 137

  Fly   257 EELGFYYSHRLLHHKHIYKYIHKQHHEWTAPISVTAIYCHPIEHIFSNLLPPFLGVFLMGSHVAT 321
            ||:.|||:||||||:.:|||:||:||||||||:...:|.||:||:.:||||....:.::|:|||.
  Fly   138 EEIMFYYAHRLLHHRSVYKYVHKKHHEWTAPIAAITLYAHPVEHVLANLLPVATSIAILGTHVAL 202

  Fly   322 AWLWFALAILSTLNAHSGYHLPFFP-SPEAHDFHHLKFNNCFGVLGVLDRLHGTDSLFRA 380
            |::.|||||:::::.|:||..|:.. |...||:||.|||..:||||.||:||||   :||
  Fly   203 AYVIFALAIINSMSDHTGYSFPWSAGSVRFHDYHHAKFNYNYGVLGFLDKLHGT---YRA 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1998NP_001285210.1 ERG3 <245..374 CDD:225546 65/129 (50%)
FA_hydroxylase 250..374 CDD:282034 65/124 (52%)
CG11162NP_572910.1 ERG3 31..269 CDD:225546 109/232 (47%)
FA_hydroxylase 131..256 CDD:282034 65/124 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448727
Domainoid 1 1.000 99 1.000 Domainoid score I2371
eggNOG 1 0.900 - - E1_COG3000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 135 1.000 Inparanoid score I1831
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1321777at2759
OrthoFinder 1 1.000 - - FOG0002076
OrthoInspector 1 1.000 - - mtm1069
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11863
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R751
SonicParanoid 00.000 Not matched by this tool.
109.930

Return to query results.
Submit another query.