DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1998 and Agmo

DIOPT Version :9

Sequence 1:NP_001285210.1 Gene:CG1998 / 32300 FlyBaseID:FBgn0030485 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_848882.2 Gene:Agmo / 319660 MGIID:2442495 Length:447 Species:Mus musculus


Alignment Length:200 Identity:48/200 - (24%)
Similarity:68/200 - (34%) Gaps:80/200 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 VCNQIFVGIPLAYASYRLMEIRGLSDIRDLP---TFHWVCFELTVCILMEELGFYYSHRLLHHKH 272
            |.:.|::     :.:|||:|         ||   |:.|....|.|     :.|:|:.||:.|..:
Mouse    94 VTSYIYI-----WENYRLLE---------LPWDSTWTWYFTFLGV-----DFGYYWFHRMAHEIN 139

  Fly   273 IYKYIHKQHH--------------------EWT--------APISVTAIYCHPIEHIFSNLLPPF 309
            |:...|:.||                    .|.        .|.||.|:      ||..|||..|
Mouse   140 IFWAAHQAHHSSEDYNLSTALRQSVLQQYSSWVFYCPLALFIPPSVFAV------HIQFNLLYQF 198

  Fly   310 LGVFLMGSHVATAWLWFALAILSTLNAHSGYHLPFFPSPEAHDFHHLKFNNCF-----GVLGVLD 369
                           |....|:.||    |.......:|..|..||.:...|.     |.|.:.|
Mouse   199 ---------------WIHTEIIRTL----GPLEVILNTPSHHRVHHGRNRYCIDKNYAGTLIIWD 244

  Fly   370 RLHGT 374
            |:.||
Mouse   245 RIFGT 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1998NP_001285210.1 ERG3 <245..374 CDD:225546 37/161 (23%)
FA_hydroxylase 250..374 CDD:282034 36/156 (23%)
AgmoNP_848882.2 ERG3 43..256 CDD:225546 47/199 (24%)
FA_hydroxylase 121..249 CDD:282034 36/157 (23%)
Histidine box-1 132..136 2/3 (67%)
Histidine box-2 145..149 1/3 (33%)
Histidine box-3 221..225 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3000
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.