Sequence 1: | NP_001285210.1 | Gene: | CG1998 / 32300 | FlyBaseID: | FBgn0030485 | Length: | 406 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_848882.2 | Gene: | Agmo / 319660 | MGIID: | 2442495 | Length: | 447 | Species: | Mus musculus |
Alignment Length: | 200 | Identity: | 48/200 - (24%) |
---|---|---|---|
Similarity: | 68/200 - (34%) | Gaps: | 80/200 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 211 VCNQIFVGIPLAYASYRLMEIRGLSDIRDLP---TFHWVCFELTVCILMEELGFYYSHRLLHHKH 272
Fly 273 IYKYIHKQHH--------------------EWT--------APISVTAIYCHPIEHIFSNLLPPF 309
Fly 310 LGVFLMGSHVATAWLWFALAILSTLNAHSGYHLPFFPSPEAHDFHHLKFNNCF-----GVLGVLD 369
Fly 370 RLHGT 374 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1998 | NP_001285210.1 | ERG3 | <245..374 | CDD:225546 | 37/161 (23%) |
FA_hydroxylase | 250..374 | CDD:282034 | 36/156 (23%) | ||
Agmo | NP_848882.2 | ERG3 | 43..256 | CDD:225546 | 47/199 (24%) |
FA_hydroxylase | 121..249 | CDD:282034 | 36/157 (23%) | ||
Histidine box-1 | 132..136 | 2/3 (67%) | |||
Histidine box-2 | 145..149 | 1/3 (33%) | |||
Histidine box-3 | 221..225 | 1/3 (33%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG3000 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |