DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1998 and Fa2h

DIOPT Version :9

Sequence 1:NP_001285210.1 Gene:CG1998 / 32300 FlyBaseID:FBgn0030485 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001129055.1 Gene:Fa2h / 307855 RGDID:1310347 Length:372 Species:Rattus norvegicus


Alignment Length:332 Identity:64/332 - (19%)
Similarity:113/332 - (34%) Gaps:122/332 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 RNVLTWHLQSFW--GASGDFWQSQWDKFIDSFGDEPMVLW------VFGTTI-FTMLVYWTVGTL 172
            ::::.|.....|  |..|:    ::|:::......|:.|:      .|..|: :::.:.|....|
  Rat   121 KDLVDWQKPLLWQVGHLGE----KYDEWVHQPVARPIRLFHSDLIEAFSKTVWYSVPIIWVPLVL 181

  Fly   173 YT----FMDLTNRPACL-----RKYKIQPGTNEPVEVRRLLKVIWCVVCNQIFVGIPLAYASYRL 228
            |.    :..||.....|     |.|.:                   ||...:|:|:.:       
  Rat   182 YLSWSYYRTLTQDNIRLFASFTRDYSL-------------------VVPESVFIGLFV------- 220

  Fly   229 MEIRGLSDIRDLPTFHWVCFELTVCILMEELGFYYSHRLLHH------KH----IYKYIHKQHHE 283
                       |....|...|            |..||.|.|      .|    ::..:|.|||:
  Rat   221 -----------LGMLIWTLVE------------YLIHRFLFHMKPPSNSHYLIMLHFVMHGQHHK 262

  Fly   284 WTAPISVTAIYCHPIEHIFSNLLPPFLGVFL-MGSHVATAWLWFALAILSTLNAHSGYHLPFFPS 347
              ||...:.:...|:.   ::::..|..||| :....|.|.:.||..:|..:.....::...|.|
  Rat   263 --APFDGSRLVFPPVP---ASVVVAFFYVFLRLILPEAVAGILFAGGLLGYVLYDMTHYYLHFGS 322

  Fly   348 P---------EAHDF-HHLKFNNC-FGVLGVLDRLHGTDSLFRATK--SYARHIMMLSFKPPRDA 399
            |         :||.. ||.::... ||:               :||  .|..|.::     |.:|
  Rat   323 PHKGSYLYNMKAHHVKHHFEYQKSGFGI---------------STKLWDYFFHTLI-----PEEA 367

  Fly   400 FPDPTMK 406
              ||.|:
  Rat   368 --DPKMQ 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1998NP_001285210.1 ERG3 <245..374 CDD:225546 33/150 (22%)
FA_hydroxylase 250..374 CDD:282034 31/145 (21%)
Fa2hNP_001129055.1 Cyt-b5 12..86 CDD:395121
FA_hydroxylase 124..372 CDD:412761 63/327 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3000
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.