DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1998 and AT4G22755

DIOPT Version :9

Sequence 1:NP_001285210.1 Gene:CG1998 / 32300 FlyBaseID:FBgn0030485 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_567669.1 Gene:AT4G22755 / 28720173 AraportID:AT4G22755 Length:291 Species:Arabidopsis thaliana


Alignment Length:299 Identity:84/299 - (28%)
Similarity:127/299 - (42%) Gaps:54/299 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 AAFILFRNVLTWHLQSFWGASGDFWQSQWDKFIDSFGDEPMVLW-VFGTTIFTM-LVYWTVGTLY 173
            |:..|.|| ||| .::.|     |..|........:....:||: ||....|.: :|.||     
plant    10 ASVALGRN-LTW-FETVW-----FDYSATKSNFHVYCHTILVLFLVFSLAPFPLVIVEWT----- 62

  Fly   174 TFMDLTNRPACLRKYKIQPGTNEPV--------EVRRLLKVIWCVVCNQIFVGIPLAYASYRLME 230
                     ....::|||......:        ||.:|..::         || .|...||..::
plant    63 ---------GWFDQFKIQKKVKYSLSDMFQCYKEVMKLFLLV---------VG-TLQIVSYPSIQ 108

  Fly   231 IRGLSDIRDLPTFHWVCFELTVCILMEELGFYYSHRLLHHKHIYKYIHKQHHEWTAPISVTAIYC 295
            :.|:.....||:...:..:|.|..|:|:...|:.||.:|.|..|:.||:.|||:|:||...:.|.
plant   109 MVGIRSGLPLPSLMEIVAQLVVYFLIEDYTNYWIHRWMHCKWGYEKIHRIHHEYTSPIGYASPYA 173

  Fly   296 HPIEHIFSNLLPPFLGVFLMGSHVATAWLWFALAILSTLNAHSGYH--------LPFFPSPEAHD 352
            |..|.:... :|.|||..:...|:.|.|||.:|.....:..||||.        :||:..||.||
plant   174 HWAEILILG-IPTFLGPAIAPGHIMTFWLWISLRQFEAIETHSGYDFPWSVTKLIPFYGGPEYHD 237

  Fly   353 FHHL----KFNNCFGVLGVLDRLHGTDSLFRATKSYARH 387
            :||.    ..:|...|....|.::|||..:|..|....|
plant   238 YHHYVGGQSQSNFASVFTYCDYIYGTDKGYRIHKKLLHH 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1998NP_001285210.1 ERG3 <245..374 CDD:225546 46/140 (33%)
FA_hydroxylase 250..374 CDD:282034 46/135 (34%)
AT4G22755NP_567669.1 FA_hydroxylase 128..263 CDD:397991 46/135 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 99 1.000 Domainoid score I2371
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 135 1.000 Inparanoid score I1831
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1321777at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1069
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11863
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.