DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1998 and sur2

DIOPT Version :9

Sequence 1:NP_001285210.1 Gene:CG1998 / 32300 FlyBaseID:FBgn0030485 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_596489.1 Gene:sur2 / 2541225 PomBaseID:SPBC887.15c Length:293 Species:Schizosaccharomyces pombe


Alignment Length:248 Identity:56/248 - (22%)
Similarity:99/248 - (39%) Gaps:47/248 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 EPMVLW--VFGTTIFTMLVYWTVGTLYTFMDLTNRPACLRKYKIQPGTNEPVEVRR--------- 202
            |.:..|  |..:.:..:::||.....:.|:.....|. ..||:|.|    |.|:.|         
pombe     6 EMLTTWNPVTVSLVSPVIIYWVASAFFGFLHYIELPV-FEKYRIHP----PEEIARRNRVPQMAV 65

  Fly   203 LLKVIWCVVCNQIFVGIPLA-----------------YASYRLMEIRGLSDIRDLP---TFHWV- 246
            :..|::..:| ::.|||.||                 |.::....:..|..:....   .:::: 
pombe    66 VKAVLFQQLC-EVVVGIALAMFEGYPEPIDEAKQMLRYEAFFSKNLPALLQVAPFAPKLAYNFIV 129

  Fly   247 -CFELTVCILMEELGFYYSHRLLHH-KHIYKYIHKQHHEWTAPISVTAIYCHPIEHIFSNLLPPF 309
             .|:......:.:...|:.||.||: |.:|..||..||....|.::.|:|.||.|.:..:.....
pombe   130 PAFQYFFAFFIIDSWQYFWHRYLHYNKKLYNMIHAHHHRLQVPYAMGALYNHPFEGLILDTFGAG 194

  Fly   310 LGVFLMGSHVATAWLWFALAILSTLNAHSGYHLPFFP-------SPEAHDFHH 355
            :.....|.....|.::|.|:.|.|::.|.||..|:.|       :...||.||
pombe   195 VAYLAAGLSPQQAVIFFTLSTLKTVDDHCGYVFPYDPLQMFFANNARYHDLHH 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1998NP_001285210.1 ERG3 <245..374 CDD:225546 33/121 (27%)
FA_hydroxylase 250..374 CDD:282034 32/114 (28%)
sur2NP_596489.1 ERG3 7..279 CDD:225546 55/247 (22%)
FA_hydroxylase 135..270 CDD:282034 32/113 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3000
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.