DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1998 and agmo-1

DIOPT Version :9

Sequence 1:NP_001285210.1 Gene:CG1998 / 32300 FlyBaseID:FBgn0030485 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_499664.2 Gene:agmo-1 / 176695 WormBaseID:WBGene00007210 Length:505 Species:Caenorhabditis elegans


Alignment Length:182 Identity:36/182 - (19%)
Similarity:74/182 - (40%) Gaps:48/182 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 IFVGIPLAYASYRLMEIRGLSDIRDLPTFHWVCFELTVCILMEELGFYYSHRLLHHKHIYKYIHK 279
            ||:.: :.:.::|::|:..     |.| :.|:     .|:..::..:|..||.:|....:..:|.
 Worm   107 IFLYV-IVWDNWRILELPW-----DSP-WTWI-----FCLFFQDFMYYLGHRAVHEAGFFWGLHT 159

  Fly   280 QHH-----EWTAPISVTAIY--------CHPIEHIFSNLLPPFLGVFLMGSHVATAWLWFA-LAI 330
            .||     .::..:...||.        |  |:..|   :||  .:||:..:.:..:.:.. .::
 Worm   160 IHHSSEYYNFSTALRQAAIQDAGLAIYDC--IQAFF---IPP--SIFLVHRYFSEIFQFIMHTSL 217

  Fly   331 LSTLNAHSGYHLPF---FPSPEAHDFHHLKFNNCF-----GVLGVLDRLHGT 374
            :.|:.       |.   |.:|..|..||.:...|.     ||..:.|::..|
 Worm   218 VDTMG-------PLGLVFNTPSHHRVHHGRNPYCIDKNYGGVFIIWDKMFNT 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1998NP_001285210.1 ERG3 <245..374 CDD:225546 29/150 (19%)
FA_hydroxylase 250..374 CDD:282034 28/145 (19%)
agmo-1NP_499664.2 ERG3 <104..293 CDD:225546 36/182 (20%)
FA_hydroxylase 130..262 CDD:282034 29/150 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3000
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.