DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1998 and Ch25h

DIOPT Version :9

Sequence 1:NP_001285210.1 Gene:CG1998 / 32300 FlyBaseID:FBgn0030485 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_034020.1 Gene:Ch25h / 12642 MGIID:1333869 Length:298 Species:Mus musculus


Alignment Length:343 Identity:67/343 - (19%)
Similarity:115/343 - (33%) Gaps:138/343 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 GSPLQN------------WDDARTADVWLSSLHSVIFIITCALAAFILFRNVLTWHLQSFWGASG 132
            ||.||:            ||..||.:.:   ..|.||.:|.::..::.|                
Mouse     6 GSELQDLGCSSQLLLQPLWDTIRTREAF---TRSPIFPVTFSIITYVGF---------------- 51

  Fly   133 DFWQSQWDKFIDSFGDEPMVLWVFGTTIFTMLVYWTVGTLYTFMDLTNRPACLRKYKIQPGTNEP 197
                                          .|.:..:..||.::.:      ||:|||.|..:. 
Mouse    52 ------------------------------CLPFVVLDVLYPWVPI------LRRYKIHPDFSP- 79

  Fly   198 VEVRRLLKVIWCVVCNQIFVGIPLAYASYRLMEIRGLSDI-RDLPTFHWVCFELTVCILMEELGF 261
             .|::||..:...:...:....|:....:    :|..:.: ::.|....:...:.:|:|:.:...
Mouse    80 -SVKQLLPCLGLTLYQHLVFVFPVTLLHW----VRSPALLPQEAPELVQLLSHVLICLLLFDTEI 139

  Fly   262 YYSHRLLHHK--HIYKYIHKQHHE--------------WTA-------PISVTAIYCHPIEHIFS 303
            :..| |||||  .:|:..||.||:              |..       .::|..:.|||:. ||:
Mouse   140 FAWH-LLHHKVPWLYRTFHKVHHQNSSSFALATQYMSFWELLSLTFFDVLNVAVLRCHPLT-IFT 202

  Fly   304 NLLPPFLGVFLMGSHVATAWLWFALAILSTLNAHSGYHLP----------FFPSPEAHDFHHLKF 358
                         .||...||        ::..||||..|          ::.....||.||.:|
Mouse   203 -------------FHVINIWL--------SVEDHSGYDFPWSTHRLVPFGWYGGVAHHDMHHSQF 246

  Fly   359 NNCFG--------VLGVL 368
            |..|.        :||.|
Mouse   247 NCNFAPYFTHWDKMLGTL 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1998NP_001285210.1 ERG3 <245..374 CDD:225546 39/165 (24%)
FA_hydroxylase 250..374 CDD:282034 39/160 (24%)
Ch25hNP_034020.1 ERG3 <128..271 CDD:225546 39/160 (24%)
FA_hydroxylase 128..263 CDD:282034 37/157 (24%)
Histidine box-1 142..146 2/4 (50%)
Histidine box-2 157..161 2/3 (67%)
Histidine box-3 238..244 3/5 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3000
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.