DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1998 and Sc5d

DIOPT Version :9

Sequence 1:NP_001285210.1 Gene:CG1998 / 32300 FlyBaseID:FBgn0030485 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_446094.1 Gene:Sc5d / 114100 RGDID:620775 Length:299 Species:Rattus norvegicus


Alignment Length:256 Identity:64/256 - (25%)
Similarity:107/256 - (41%) Gaps:62/256 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 TTIFTMLVYWTVGTL-YTFM---DLTNRPACLRKYKIQPGTNEPVEVRRLLKVIWCVVCNQIFVG 218
            |.:...::|:...|| |.|:   .|...|..|:              .::.:.|...|.:..::.
  Rat    38 TNLGAYILYFFCATLSYYFVYDHSLMKHPQFLK--------------NQVSREIMFTVKSLPWIS 88

  Fly   219 IPLAYASYRLMEIRGLS----DIRDLPTFHWVCFELTVC--ILMEELGFYYSHRLLHHKHIYKYI 277
            ||.  .|..|:|:||.|    ||.|.|. .|:...::|.  :...::..|:.||.|||:.:||:|
  Rat    89 IPT--VSLFLLELRGYSKLYDDIGDFPN-GWIHLIMSVISFLFFTDMLIYWIHRGLHHRLLYKHI 150

  Fly   278 HKQHHEWTAPISVTAIYCHPIE--------HIFSNLLP----PFLGVFLMGSHVATAWLWFALAI 330
            ||.||.|..|....:...||::        ||:..:.|    .:||::::    ...|       
  Rat   151 HKPHHIWKIPTPFASHAFHPVDGFLQSLPYHIYPFVFPLHKVVYLGLYVL----VNVW------- 204

  Fly   331 LSTLNAHSG------YHLPFFPSPEAHDFHHLKFNNCFGVLGVL-DRLHGTDSLFRATKSY 384
              |::.|.|      ...||......|..||:.|:..:|....| ||:.|:   |:...|:
  Rat   205 --TISIHDGDFRVPQIFRPFINGSAHHTDHHMLFDYNYGQYFTLWDRIGGS---FKHPSSF 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1998NP_001285210.1 ERG3 <245..374 CDD:225546 38/149 (26%)
FA_hydroxylase 250..374 CDD:282034 37/144 (26%)
Sc5dNP_446094.1 ERG3 40..257 CDD:225546 62/249 (25%)
Histidine box-1 138..143 3/4 (75%)
Histidine box-2 151..155 2/3 (67%)
Histidine box-3 228..233 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3000
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.