DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1998 and FAXDC2

DIOPT Version :9

Sequence 1:NP_001285210.1 Gene:CG1998 / 32300 FlyBaseID:FBgn0030485 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_115761.2 Gene:FAXDC2 / 10826 HGNCID:1334 Length:333 Species:Homo sapiens


Alignment Length:323 Identity:150/323 - (46%)
Similarity:209/323 - (64%) Gaps:1/323 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 GSPLQNWDDARTADVWLSSLHSVIFIITCALAAFILFRNVLTWHLQSFWGASGDFWQSQWDKFID 144
            |..|.|....:...:| .|:....||:...|.:|:.|.|.:|||||.||||||.|||:||::.:.
Human     6 GHMLHNEKSKQEGHIW-GSMRRTAFILGSGLLSFVAFWNSVTWHLQRFWGASGYFWQAQWERLLT 69

  Fly   145 SFGDEPMVLWVFGTTIFTMLVYWTVGTLYTFMDLTNRPACLRKYKIQPGTNEPVEVRRLLKVIWC 209
            :|..:..:|:..|......|.:|:...|...:|.|.:|..:.:|:||.|.||||:..:|.:.|..
Human    70 TFEGKEWILFFIGAIQVPCLFFWSFNGLLLVVDTTGKPNFISRYRIQVGKNEPVDPVKLRQSIRT 134

  Fly   210 VVCNQIFVGIPLAYASYRLMEIRGLSDIRDLPTFHWVCFELTVCILMEELGFYYSHRLLHHKHIY 274
            |:.||..:..|:....|..::.......|:||||||...||.:..|:||:.||||||||||...|
Human   135 VLFNQCMISFPMVVFLYPFLKWWRDPCRRELPTFHWFLLELAIFTLIEEVLFYYSHRLLHHPTFY 199

  Fly   275 KYIHKQHHEWTAPISVTAIYCHPIEHIFSNLLPPFLGVFLMGSHVATAWLWFALAILSTLNAHSG 339
            |.|||:||||||||.|.::|.|||||..||:||..:|..:||||:::..:||:||::.|..:|.|
Human   200 KKIHKKHHEWTAPIGVISLYAHPIEHAVSNMLPVIVGPLVMGSHLSSITMWFSLALIITTISHCG 264

  Fly   340 YHLPFFPSPEAHDFHHLKFNNCFGVLGVLDRLHGTDSLFRATKSYARHIMMLSFKPPRDAFPD 402
            |||||.||||.||:||||||.|:|||||||.|||||::|:.||:|.||:::|.|.|..::.||
Human   265 YHLPFLPSPEFHDYHHLKFNQCYGVLGVLDHLHGTDTMFKQTKAYERHVLLLGFTPLSESIPD 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1998NP_001285210.1 ERG3 <245..374 CDD:225546 79/128 (62%)
FA_hydroxylase 250..374 CDD:282034 77/123 (63%)
FAXDC2NP_115761.2 FA_hydroxylase 175..299 CDD:309300 77/123 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146981
Domainoid 1 1.000 183 1.000 Domainoid score I3445
eggNOG 1 0.900 - - E1_COG3000
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41863
Inparanoid 1 1.050 331 1.000 Inparanoid score I2446
Isobase 1 0.950 - 0 Normalized mean entropy S2297
OMA 1 1.010 - - QHG48620
OrthoDB 1 1.010 - - D1321777at2759
OrthoFinder 1 1.000 - - FOG0002076
OrthoInspector 1 1.000 - - oto89402
orthoMCL 1 0.900 - - OOG6_105513
Panther 1 1.100 - - LDO PTHR11863
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R751
SonicParanoid 1 1.000 - - X3944
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.