DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1998 and ch25hl2

DIOPT Version :9

Sequence 1:NP_001285210.1 Gene:CG1998 / 32300 FlyBaseID:FBgn0030485 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001108042.1 Gene:ch25hl2 / 100136851 ZFINID:ZDB-GENE-080204-82 Length:279 Species:Danio rerio


Alignment Length:287 Identity:66/287 - (22%)
Similarity:108/287 - (37%) Gaps:41/287 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 TWH------LQSFWGASGDFWQSQWDKFIDSFGDEPMVLWVFGTTIFTMLVYWTVGTLYTFMDLT 179
            ||.      ||..|    |:.|...:..:.|    |:...:...:::.:||::     ||.:||.
Zfish     8 TWDLSNQSVLQPLW----DYLQQNHESSLRS----PLFPVILSVSMYLVLVFF-----YTVLDLL 59

  Fly   180 NRPA--CLRKYKIQPGTNEPVEVRRLLKVIWCVVCNQIFVGIPLAYASYRLMEIRGLSDIRDLPT 242
             .|.  .:|:|:|.  .:..|....:...:.....|.:....|.|.|.:.......|.  |:.||
Zfish    60 -APTWPSIRRYQIH--QDRTVTWSNIGSTLALTTYNHLLYIFPAAVAQWLWRPPIPLP--REAPT 119

  Fly   243 FHWVCFELTVCILMEELGFYYSHRLLHHK--HIYKYIHKQHHEWTAPISVTAIYCHPIEHIFSNL 305
            .......:..|.::.:..:|..| ||||:  .:|:..|..||::....|:...|....| :||..
Zfish   120 LTAFLLGIVGCTVVFDFQYYLWH-LLHHRVGWLYRTFHALHHQYRQTFSLVTQYLSAWE-LFSVG 182

  Fly   306 LPPFLGVFLMGSHVATAWLWFALAILSTLNAHSGYHLPF----------FPSPEAHDFHH-LKFN 359
            ....:...|:..|..|||.:....|..:...|.||..|:          :.....||.|| |...
Zfish   183 FWTTVDPLLLQCHCLTAWAFMLFNIWVSTEDHCGYDFPWAMHRLVPFGLWGGALRHDAHHQLPGT 247

  Fly   360 NCFGVLGVLDRLHGTDSLFRATKSYAR 386
            |........|.|.||.::....|:..|
Zfish   248 NFAPFFAHWDWLGGTATMPAPVKTKKR 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1998NP_001285210.1 ERG3 <245..374 CDD:225546 34/141 (24%)
FA_hydroxylase 250..374 CDD:282034 34/136 (25%)
ch25hl2NP_001108042.1 FA_hydroxylase 127..262 CDD:309300 34/136 (25%)
Histidine box-1. /evidence=ECO:0000255 141..145 2/4 (50%)
Histidine box-2. /evidence=ECO:0000255 156..160 1/3 (33%)
Histidine box-3. /evidence=ECO:0000255 237..243 3/5 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3000
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.