DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and GTT1

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_012304.1 Gene:GTT1 / 854856 SGDID:S000001477 Length:234 Species:Saccharomyces cerevisiae


Alignment Length:256 Identity:47/256 - (18%)
Similarity:103/256 - (40%) Gaps:55/256 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQP-LKFYFDFLNQSSRALYILLEASKIPFEAIPISM---------LKGEHLTG-----EFRDN 50
            ||.| :|.::...:::.|.|: ||:...:.:|.:|...         ||..|..|     |.:|.
Yeast     1 MSLPIIKVHWLDHSRAFRLLW-LLDHLNLEYEIVPYKRDANFRAPPELKKIHPLGRSPLLEVQDR 64

  Fly    51 VNRFRKLPAITDHGYQLSENVAIFRHLAREKLVPEHWYPRRHLGRS-------RIDEYLAWQQTN 108
            ....:|:         |:|:..||::      |.:| :...|:..|       :|:.||.:.:.:
Yeast    65 ETGKKKI---------LAESGFIFQY------VLQH-FDHSHVLMSEDADIADQINYYLFYVEGS 113

  Fly   109 M-GVATTEYFQQK-------WLVPYLQKTRPADN-AVNLASKQLEHTLNEFEQLFLNSRKFMMGD 164
            : .....|:...|       :.:.||.: :.||. :...:|.::::..:..|.....:..:::..
Yeast   114 LQPPLMIEFILSKVKDSGMPFPISYLAR-KVADKISQAYSSGEVKNQFDFVEGEISKNNGYLVDG 177

  Fly   165 NISYADLSAICEIDQPKSIGYNAFQNRNKLARWYETVREELGPHYKEVLGEFEAKLKGSGS 225
            .:|.||:.....:.......:.|.::...:::|.:|:..|      |.....:.|.:..||
Yeast   178 KLSGADILMSFPLQMAFERKFAAPEDYPAISKWLKTITSE------ESYAASKEKARALGS 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 18/88 (20%)
GST_C_Theta 95..220 CDD:198292 20/140 (14%)
GTT1NP_012304.1 GST_N_GTT1_like 6..87 CDD:239344 20/97 (21%)
GST_C_GTT1_like 93..218 CDD:198298 19/131 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.