DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and YGR201C

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_011717.4 Gene:YGR201C / 853115 SGDID:S000003433 Length:225 Species:Saccharomyces cerevisiae


Alignment Length:236 Identity:50/236 - (21%)
Similarity:94/236 - (39%) Gaps:56/236 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SSRALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNR---------FRKLPA-ITDHG-YQLS 68
            |...|:..|:..|:....:|..:::...|..:..|..:.         .||.|. :..|. :.|:
Yeast     2 SDGTLFTDLKERKLIRTIVPRGLVRSLKLDVKLADPSDAQQLYEREFPLRKYPTFVGPHDEWTLT 66

  Fly    69 ENVAI---FRHLAREK------LVPEHWYPRRHLGRSRIDEYLAWQQTNMGVATTE----YFQQK 120
            |.:||   ..||:.:|      |.||..:      ::|.| .|.|:..:......|    :|...
Yeast    67 EAMAIDYYLIHLSSDKEAVRQLLGPEGDF------KTRAD-ILRWESLSNSDFLNEVCEVFFPLI 124

  Fly   121 WLVPYLQKTRPADNAVNL--ASKQLEHTLNEFEQLFLNSRKFMMGDNISYADLSAICEIDQPKSI 183
            .:.||        ||...  |.:.::..::.:|:.....:..:..|:.:.|||.:....    |:
Yeast   125 GVKPY--------NATEFKAARENVDTIVSLYEKRLKKQQYLVCDDHETLADLISAAAF----SL 177

  Fly   184 GYNAFQN---RNK---LARWYETVREELGPHYKEVLGEFEA 218
            |:.:|.:   |:|   :.||:..|   :...:.|  ||||:
Yeast   178 GFISFFDETWRSKHPEVTRWFNRV---IKSRFFE--GEFES 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 17/78 (22%)
GST_C_Theta 95..220 CDD:198292 29/136 (21%)
YGR201CNP_011717.4 Thioredoxin_like 4..78 CDD:412351 14/73 (19%)
GST_C_EF1Bgamma_like 98..220 CDD:198290 29/134 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345019
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.