DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and GSTF5

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001322019.1 Gene:GSTF5 / 839479 AraportID:AT1G02940 Length:281 Species:Arabidopsis thaliana


Alignment Length:220 Identity:49/220 - (22%)
Similarity:89/220 - (40%) Gaps:56/220 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KFY-FDFLNQSSRALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGYQLSE 69
            |.| :.:...:.|.|.:|.|.. :.::.|.::::.|:.....|. .:|.|.::|...|.|.:|:|
plant    65 KIYGYPYSTNTRRVLAVLHEKG-LSYDPITVNLIAGDQKKPSFL-AINPFGQVPVFLDGGLKLTE 127

  Fly    70 NVAIFRHLAR------EKLVPEHWYPRRHLGRSR----IDEY--------LAWQQT--NMGVATT 114
            :.||..::|.      .:|:....|  :.:|..|    |:.:        |.|:|:  .|....|
plant   128 SRAISEYIATVHKSRGTQLLNYKSY--KTMGTQRMWMAIESFEFDPLTSTLTWEQSIKPMYGLKT 190

  Fly   115 EYFQQKWLVPYLQKTRPADNAVNLASKQLEHTLNEFEQLFLNSRKFMMGDNISYADLSAICEIDQ 179
            :|                 ..||....:||..|:.:|:...|| .|:..::.:.|||..:     
plant   191 DY-----------------KVVNETEAKLEKVLDIYEERLKNS-SFLASNSFTMADLYHL----- 232

  Fly   180 PKSIGY-------NAFQNRNKLARW 197
             .:|.|       ..|.||..:.||
plant   233 -PNIQYLMDTHTKRMFVNRPSVRRW 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 19/80 (24%)
GST_C_Theta 95..220 CDD:198292 27/124 (22%)
GSTF5NP_001322019.1 GST_N_Phi 65..136 CDD:239351 18/72 (25%)
GST_C_Phi 153..270 CDD:198296 28/128 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.