DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and GSTF7

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_171791.1 Gene:GSTF7 / 839295 AraportID:AT1G02920 Length:209 Species:Arabidopsis thaliana


Alignment Length:231 Identity:56/231 - (24%)
Similarity:82/231 - (35%) Gaps:67/231 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SSRALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGYQLSENVAIFRHLAR 79
            ::|.:.|.|....:.||.:.|.:..|||....|... |.|.|:||..|..::|.|:.||.:::| 
plant    14 ATRRVLIALHEKNLDFEFVHIELKDGEHKKEPFIFR-NPFGKVPAFEDGDFKLFESRAITQYIA- 76

  Fly    80 EKLVPEHWYPRR-----HLGRSRI-----------DEY------LAWQQT---NMGVATTEYFQQ 119
                  |:|..:     .||...|           .|:      |.|:|.   ..|:.|      
plant    77 ------H
FYSDKGNQLVSLGSKDIAGIAMGIEIESHEFDPVGSKLVWEQVLKPLYGMTT------ 129

  Fly   120 KWLVPYLQKTRPADNAVNLASKQL---EHTLNEFEQLFLNSRKFMMGDNISYADLSAICEID--- 178
                   .||...:....|| |.|   ||.|.|        .|::..|..:..||..|..|.   
plant   130 -------DKTVVEEEEAKLA-KVLDVYEHRLGE--------SKYLASDKFTLVDLHTIPVIQYLL 178

  Fly   179 -QPKSIGYNAFQNRNKLARWYETVREELGPHYKEVL 213
             .|..   ..|..|..::.|...:...  |..|:||
plant   179 GTPTK---KLFDERPHVSAWVADITSR--PSAKKVL 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 21/64 (33%)
GST_C_Theta 95..220 CDD:198292 31/146 (21%)
GSTF7NP_171791.1 GST_N_Phi 4..77 CDD:239351 21/70 (30%)
GST_C_Phi 95..209 CDD:198296 28/140 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.