DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and GSTF4

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001320441.1 Gene:GSTF4 / 838240 AraportID:AT1G02950 Length:255 Species:Arabidopsis thaliana


Alignment Length:232 Identity:49/232 - (21%)
Similarity:85/232 - (36%) Gaps:66/232 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KFYFDFLNQSSRALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGYQLSEN 70
            |.:.|..:.::|.:..:|...::.:|.|.:.:..|||.|..|. ::|.|.::|...|...:|.|:
plant    38 KVHGDPFSTNTRRVLAVLHEKRLSYEPITVKLQTGEHKTEPFL-SLNPFGQVPVFEDGSVKLYES 101

  Fly    71 VAIFRHLAREKLVPEHWYPRRHLGRSRID-------------------------EYLAWQQTNMG 110
            .||.:::|         |.....|...::                         ..|.|:|....
plant   102 RAITQYIA---------YVHSSRGTQLLNLRSHETMATLTMWMEIEAHQFDPPASKLTWEQVIKP 157

  Fly   111 VATTEYFQQKWLVPYLQKTRPA--DNAVNLASKQLEHTLNEFEQLFLNSRKFMMGD-----NISY 168
            :...|..|.      :.|...|  :..:|:..|:||      |..||....|.:.|     ||.|
plant   158 IYGLETDQT------IVKENEAILEKVLNIYEKRLE------ESRFLACNSFTLVDLHHLPNIQY 210

  Fly   169 ADLSAICEIDQPKSIGYNAFQNRNKLARWYE--TVRE 203
            .       :..|..   ..|:.|:|:.:|.:  |.||
plant   211 L-------LGTPTK---KLFEKRSKVRKWVDEITSRE 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 20/73 (27%)
GST_C_Theta 95..220 CDD:198292 27/143 (19%)
GSTF4NP_001320441.1 GST_N_Phi 38..109 CDD:239351 19/71 (27%)
GST_C_Phi 126..243 CDD:198296 27/134 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.