DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and GSTT3

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_198938.1 Gene:GSTT3 / 834124 AraportID:AT5G41220 Length:590 Species:Arabidopsis thaliana


Alignment Length:222 Identity:72/222 - (32%)
Similarity:107/222 - (48%) Gaps:23/222 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LKFYFDFLNQSSRALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGYQLSE 69
            ||.|.|.::|.|||:.|..:.::|.|:.|.|.:...:.|:.||:| :|...|:|||.|...:|||
plant     3 LKVYADRMSQPSRAVLIFCKVNEIQFDEILIYLANRQQLSPEFKD-INPMGKVPAIVDGKLKLSE 66

  Fly    70 NVAIFRHLARE-KLVPEHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQQKWLVPYL---QKTR 130
            :.||..:|:.. ..|.:||||.....|:||...|.|..||:......|.....|.|.|   ...:
plant    67 SHAILIYLSSAYPSVVDHWYPTDLSKRARIHSVLDWHHTNLRPGAAGYVLNSVLGPALGLPLNPK 131

  Fly   131 PADNAVNLASKQLEHTLNEFEQLFLNSRKFMMGDN-ISYADLSAICEIDQPKSIGYNAFQNRNKL 194
            .|..|..|.:|.|. ||:.|  ....:..|::|.| .|.||||.:||:.|     .....::::|
plant   132 AAAEAEQLLTKSLT-TLDTF--WLKGNAMFLLGSNQPSIADLSLVCELTQ-----LQVLDDKDRL 188

  Fly   195 ---------ARWYETVREELGPHYKEV 212
                     .:|.|..|:...||:.||
plant   189 RLLSPHKNVEQWIENTRKATMPHFDEV 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 29/74 (39%)
GST_C_Theta 95..220 CDD:198292 38/131 (29%)
GSTT3NP_198938.1 PLN02473 1..202 CDD:166114 66/207 (32%)
GST_N_Theta 3..78 CDD:239348 29/75 (39%)
GST_C_Theta 92..221 CDD:198292 38/132 (29%)
NAM-associated 378..>455 CDD:291001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3657
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm1047
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.780

Return to query results.
Submit another query.