DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and GSTT1

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_198937.1 Gene:GSTT1 / 834123 AraportID:AT5G41210 Length:245 Species:Arabidopsis thaliana


Alignment Length:216 Identity:70/216 - (32%)
Similarity:105/216 - (48%) Gaps:13/216 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LKFYFDFLNQSSRALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGYQLSE 69
            ||.|.|.::|.|||:.|..:.:.|.|:.:.||:.|.:.|:.||:| :|...|:|||.|...:|.|
plant     4 LKVYADRMSQPSRAVIIFCKVNGIQFDEVLISLAKRQQLSPEFKD-INPLGKVPAIVDGRLKLFE 67

  Fly    70 NVAIFRHLARE-KLVPEHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQQKWLVPYL---QKTR 130
            :.||..:|:.. ..|.:||||.....|::|...|.|..||:......|.....|.|.|   ...:
plant    68 SHAILIYLSSAFPSVADHWYPNDLSKRAKIHSVLDWHHTNLRRGAAGYVLNSVLGPALGLPLNPK 132

  Fly   131 PADNAVNLASKQLEHTLNEFEQLFLNSRKFMMGDN-ISYADLSAICEIDQPKSIG----YNAFQN 190
            .|..|..|.:|.|. ||..|  ....:.||::|.| .|.||||.:||:.|.:.:.    ......
plant   133 AAAEAEQLLTKSLS-TLETF--WLKGNAKFLLGSNQPSIADLSLVCELMQLQVLDDKDRLRLLST 194

  Fly   191 RNKLARWYETVREELGPHYKE 211
            ..|:.:|.|..::...||:.|
plant   195 HKKVEQWIENTKKATMPHFDE 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 29/74 (39%)
GST_C_Theta 95..220 CDD:198292 36/125 (29%)
GSTT1NP_198937.1 GST_N_Theta 4..79 CDD:239348 29/75 (39%)
GST_C_Theta 93..223 CDD:198292 36/126 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3657
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 117 1.000 Inparanoid score I2004
OMA 1 1.010 - - QHG54888
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm1047
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.840

Return to query results.
Submit another query.