DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and GSTF12

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_197224.1 Gene:GSTF12 / 831586 AraportID:AT5G17220 Length:214 Species:Arabidopsis thaliana


Alignment Length:227 Identity:54/227 - (23%)
Similarity:93/227 - (40%) Gaps:63/227 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RALYILLEASKIPFEAIPISM-----LKGEHLTGEFRDNVNRFRKLPAITDHGYQLSENVAIFRH 76
            |.|...||.. |.||.|.|.:     .|.|||..:      .|.::|||.|..::|.|:.||.|:
plant    16 RVLLCFLEKG-IEFEIIHIDLDTFEQKKPEHLLRQ------PFGQVPAIEDGDFKLFESRAIARY 73

  Fly    77 LARE----------KLVPEHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQ---QKWLVPYLQK 128
            .|.:          |.: ||        |:.:|:   |....     |.||.   |..::..:.|
plant    74 YATKFADQGTNLLGKSL-EH--------RAIVDQ---WADVE-----TYYFNVLAQPLVINLIIK 121

  Fly   129 TRPADNAVNLASKQLEHTLNEFEQLF---LNSRKFMMGDNISYADLS---------AICEIDQPK 181
            .|..:....:..:.|:..|.....::   |:|.:|:.|:..:.|||:         :|.:|:|  
plant   122 PRLGEKCDVVLVEDLKVKLGVVLDIYNNRLSSNRFLAGEEFTMADLTHMPAMGYLMSITDINQ-- 184

  Fly   182 SIGYNAFQNRNKLARWYETVREELGPHYKEVL 213
                 ..:.|....||:|.:.:.  |.:|:::
plant   185 -----MVKARGSFNRWWEEISDR--PSWKKLM 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 24/67 (36%)
GST_C_Theta 95..220 CDD:198292 27/134 (20%)
GSTF12NP_197224.1 PLN02473 1..214 CDD:166114 54/227 (24%)
GST_N_Phi 2..77 CDD:239351 24/67 (36%)
GST_C_Phi 91..209 CDD:198296 29/142 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.