DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and GSTF2

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_192161.1 Gene:GSTF2 / 827931 AraportID:AT4G02520 Length:212 Species:Arabidopsis thaliana


Alignment Length:204 Identity:48/204 - (23%)
Similarity:79/204 - (38%) Gaps:40/204 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SSRALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGYQLSENVAIFRHLAR 79
            ::|.:.|.|....:.||.:.:.:..|||....|... |.|.::||..|...:|.|:.||.:::| 
plant    14 ATRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSR-NPFGQVPAFEDGDLKLFESRAITQYIA- 76

  Fly    80 EKLVPEHWYPRRHLGRSRIDEYLAWQQTNMG------------VATTEYFQQKWLVPYLQKTRPA 132
                  |.|..:.....:.|.....|...|.            ||:...|:|.:...|...|   
plant    77 ------HR
YENQGTNLLQTDSKNISQYAIMAIGMQVEDHQFDPVASKLAFEQIFKSIYGLTT--- 132

  Fly   133 DNAVNLASKQ--LEHTLNEFEQLFLNSRKFMMGDNISYADLSAICEIDQPKSIGY-------NAF 188
            |.|| :|.::  |...|:.:|.. |...|::.|:..:..||..|      .:|.|       ..|
plant   133 DEAV-VAEEEAKLAKVLDVYEAR-LKEFKYLAGETFTLTDLHHI------PAIQYLLGTPTKKLF 189

  Fly   189 QNRNKLARW 197
            ..|.::..|
plant   190 TERPRVNEW 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 19/64 (30%)
GST_C_Theta 95..220 CDD:198292 27/124 (22%)
GSTF2NP_192161.1 GST_N_Phi 4..78 CDD:239351 19/71 (27%)
GST_C_Phi 96..211 CDD:198296 26/114 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.