DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and GSTF9

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_180643.1 Gene:GSTF9 / 817636 AraportID:AT2G30860 Length:215 Species:Arabidopsis thaliana


Alignment Length:236 Identity:56/236 - (23%)
Similarity:102/236 - (43%) Gaps:51/236 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LKFYFDFLNQSSRALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGYQLSE 69
            ||.|........|||..|:|.. :.||.||:.::||||....:. .:..|..:||:.|..|::.|
plant     3 LKVYGPHFASPKRALVTLIEKG-VAFETIPVDLMKGEHKQPAYL-ALQPFGTVPAVVDGDYKIFE 65

  Fly    70 NVAIFRHLARE----------KLVPEHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQQKWLVP 124
            :.|:.|::|.:          |.|.:         |.:::::|       .|..|.|..     |
plant    66 SRAVMRYVAEKYRSQGPDLLGKTVED---------RGQVEQWL-------DVEATTYHP-----P 109

  Fly   125 YLQKTR----------PAD-NAVNLASKQLEHTLNEFEQLFLNSRKFMMGDNISYADLSAICEID 178
            .|..|.          |:| ..:..:.::|...|:.:| ..|:..|::.||.:|.|||:.:...|
plant   110 LLNLTLHIMFASVMGFPSDEKLIKESEEKLAGVLDVYE-AHLSKSKYLAGDFVSLADLAHLPFTD 173

  Fly   179 Q---PKSIGYNAFQNRNKLARWYETVREELGPHYKEVLGEF 216
            .   |....| ..::|..::.|::.:...  |.:||.:.::
plant   174 YLVGPIGKAY-MIKDRKHVSAWWDDISSR--PAWKETVAKY 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 25/74 (34%)
GST_C_Theta 95..220 CDD:198292 29/136 (21%)
GSTF9NP_180643.1 PLN02395 1..215 CDD:166036 56/236 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.