DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and GSTF3

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_178394.1 Gene:GSTF3 / 814822 AraportID:AT2G02930 Length:212 Species:Arabidopsis thaliana


Alignment Length:234 Identity:52/234 - (22%)
Similarity:84/234 - (35%) Gaps:70/234 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SSRALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGYQLSENVAIFRHLAR 79
            |:|.:.|.|....:.||.:.:.:..|||....|... |.|.::||..|...:|.|:.||.:::|.
plant    14 STRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSR-NPFGQVPAFEDGDLKLFESRAITQYIAH 77

  Fly    80 E------KLVPEHWYPRRHLGRSRIDEY--------------------LAWQQT---NMGVATTE 115
            .      .|:|        .....|.:|                    |||:|.   |.|:.|  
plant    78 RYENQGTNLLP--------ADSKNIAQYAIMSIGIQVEAHQFDPVASKLAWEQVFKFNYGLNT-- 132

  Fly   116 YFQQKWLVPYLQKTRPADNAVNLASKQ--LEHTLNEFEQLFLNSRKFMMGDNISYADLSAICEID 178
                             |.|| :|.::  |...|:.:|.. |...|::.|:..:..||..|..|.
plant   133 -----------------DQAV-VAEEEAKLAKVLDVYEAR-LKEFKYLAGETFTLTDLHHIPVIQ 178

  Fly   179 ----QPKSIGYNAFQNRNKLARWYETVREELGPHYKEVL 213
                .|..   ..|..|.::..|...:.:.  |..::||
plant   179 YLLGTPTK---KLFTERPRVNEWVAEITKR--PASEKVL 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 20/64 (31%)
GST_C_Theta 95..220 CDD:198292 30/148 (20%)
GSTF3NP_178394.1 PLN02473 4..212 CDD:166114 50/232 (22%)
GST_N_Phi 4..78 CDD:239351 20/64 (31%)
GST_C_Phi 96..212 CDD:198296 27/141 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.