DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and Gstt4

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_083748.3 Gene:Gstt4 / 75886 MGIID:1923136 Length:240 Species:Mus musculus


Alignment Length:209 Identity:75/209 - (35%)
Similarity:117/209 - (55%) Gaps:16/209 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LKFYFDFLNQSSRALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGYQLSE 69
            |:.|.|.|:...||:||....:.|||:...:.:|||.|.:.|:.: :|..||||::.|..:.|||
Mouse     3 LELYMDLLSAPCRAVYIFARKNGIPFDFQFVDLLKGHHHSKEYIE-INPLRKLPSLKDGKFILSE 66

  Fly    70 NVAIFRHLAREKLVPEHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQQKWLVPYLQKTRPADN 134
            :|||..:|.|:...|.||||.....|:|:||::|||.|.:.|..::....|.::|.:       .
Mouse    67 SVAILFYLCRKYSAPSHWYPPDLHMRARVDEFMAWQHTAIQVPMSKILWIKLIIPMI-------T 124

  Fly   135 AVNLASKQLEHTLNE-------FEQLFLNSRKFMMGDNISYADLSAICEIDQPKSIGYNAFQNRN 192
            ...:.:::||.||:|       ||:.||..:.|:.||:||.|||.|:.|:.||....:|.|.: :
Mouse   125 GEEVPTERLEKTLDEVKRNLQQFEEKFLQDKMFITGDHISLADLVALVEMMQPMGSNHNVFVS-S 188

  Fly   193 KLARWYETVREELG 206
            |||.|...|...:|
Mouse   189 KLAEWRMRVELAIG 202

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 29/74 (39%)
GST_C_Theta 95..220 CDD:198292 40/119 (34%)
Gstt4NP_083748.3 GstA 3..>170 CDD:223698 63/174 (36%)
GST_N_Theta 3..78 CDD:239348 30/75 (40%)