DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and GstD10

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster


Alignment Length:196 Identity:47/196 - (23%)
Similarity:93/196 - (47%) Gaps:13/196 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RALYILLEASKIPFEAIPISMLKG-EHLTGEFRDNVNRFRKLPAITDHGYQLSENVAIFRHLARE 80
            |::.:..:|..:.|:...|...:. |..|.|:. .:|....:|.:.|||:.|.|:.||..:|..:
  Fly    13 RSVLMTAKALGVEFDKKTIINTRAREQFTPEYL-KINPQHTIPTLHDHGFALWESRAIMVYLVEK 76

  Fly    81 KLVPEHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQQKWLVPYLQKTRPADNAVNLASKQLEH 145
            ....:..:|:....::.|::.|.:....:..:.:||:     .|.:...:|| |..|.  |::|.
  Fly    77 YGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYY-----YPQIFLKKPA-NEENY--KKIEV 133

  Fly   146 TLNEFEQLFLNSRKFMMGDNISYADLSAICEIDQPKSIGYNAFQNRNKLARWYETVREELGPHYK 210
            .. ||...||..:.:..|.:.|.||::.:..:......|:: |:....:|||||..: :|.|.::
  Fly   134 AF-EFLNTFLEGQTYSAGGDYSLADIAFLATVSTFDVAGFD-FKRYANVARWYENAK-KLTPGWE 195

  Fly   211 E 211
            |
  Fly   196 E 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 17/63 (27%)
GST_C_Theta 95..220 CDD:198292 29/117 (25%)
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 17/62 (27%)
PLN02473 3..196 CDD:166114 46/194 (24%)
GST_C_Delta_Epsilon 89..205 CDD:198287 29/119 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459974
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
65.750

Return to query results.
Submit another query.