DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and Gstt3

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:XP_038954940.1 Gene:Gstt3 / 499422 RGDID:1562732 Length:298 Species:Rattus norvegicus


Alignment Length:219 Identity:84/219 - (38%)
Similarity:120/219 - (54%) Gaps:5/219 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LKFYFDFLNQSSRALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGYQLSE 69
            |:.|.|.::|..||:||..:.:.|||:...|.:|||:|.|..|. .||..||:||:.|..:.|:|
  Rat    60 LELYLDLMSQPCRAVYIFAKKNGIPFQLRTIELLKGQHYTDAFA-QVNPLRKVPALKDGDFVLAE 123

  Fly    70 NVAIFRHLAREKLVPEHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQQKWLVPYL--QKTRPA 132
            :|||..:|:|:...|:||||:....|:|:|||||||.|.:....:....||.:.|..  |...|.
  Rat   124 SVAILLYLSRKYKAPDHWYPQDLQTRARVDEYLAWQHTALRSCCSRAMWQKMMFPVFLGQPVPPE 188

  Fly   133 DNAVNLASKQLEHTLNEFEQLFLNSRKFMMGDNISYADLSAICEIDQPKSIGYNAFQNRNKLARW 197
            ..|..||  :|:..|...|..||.::.|:.|.:||.|||.||.|:..|.|.|...|::|.|||.|
  Rat   189 RLASTLA--ELDGCLQMLEDKFLQNKAFLTGPHISVADLVAITELMHPVSAGCKIFESRPKLAAW 251

  Fly   198 YETVREELGPHYKEVLGEFEAKLK 221
            .:.|...:|....:...|...|.|
  Rat   252 RQRVEAAVGESLFQEAHEVVLKAK 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 31/74 (42%)
GST_C_Theta 95..220 CDD:198292 45/126 (36%)
Gstt3XP_038954940.1 GST_N_Theta 60..135 CDD:239348 32/75 (43%)
GST_C_Theta 149..273 CDD:198292 45/125 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm9022
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.