DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and GstD5

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster


Alignment Length:223 Identity:44/223 - (19%)
Similarity:101/223 - (45%) Gaps:21/223 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LKFYFDFLNQSSRALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGYQLSE 69
            :.||:.......|.:.::.:|..:......::.|:.:.|..|| ..:|....:|.:.|:|:.:.|
  Fly     1 MDFYYSPRGSGCRTVIMVAKALGVKLNMKLLNTLEKDQLKPEF-VKLNPQHTIPTLVDNGFSIWE 64

  Fly    70 NVAIFRHLAREKLVPEHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQQKWLVPYLQKTRPADN 134
            :.||..:|..:....:..:|:....::.:::.|.:   :||.....:  .|:..|.....:|..:
  Fly    65 SRAIAVYLVEKYGKDDTLFPKDPKKQALVNQRLYF---DMGTLYDSF--AKYYYPLFHTGKPGSD 124

  Fly   135 AVNLASKQLEHTLNEFEQLFLNSRKFMMGDNISYADLSAICEIDQPKSIGY--NAFQNRNKLARW 197
            .   ..|::|.:. |:..:||..:.::.||:::.||::.:..:...:...:  |.:.|   :|||
  Fly   125 E---DFKKIESSF-EYLNIFLEGQNYVAGDHLTVADIAILSTVSTFEIFDFDLNKYPN---VARW 182

  Fly   198 YETVR------EELGPHYKEVLGEFEAK 219
            |...:      ||......|:.|.|:|:
  Fly   183 YANAKKVTPGWEENWKGAVELKGVFDAR 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 16/74 (22%)
GST_C_Theta 95..220 CDD:198292 27/133 (20%)
GstD5NP_524914.3 GstA 1..184 CDD:223698 37/195 (19%)
GST_N_Delta_Epsilon 1..74 CDD:239343 16/73 (22%)
GST_C_Delta_Epsilon 88..204 CDD:198287 24/127 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459970
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
65.750

Return to query results.
Submit another query.