DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and GstD2

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster


Alignment Length:201 Identity:40/201 - (19%)
Similarity:93/201 - (46%) Gaps:15/201 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LKFYFDFLNQSSRALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGYQLSE 69
            :.||:.......|.:.::.:|..:......::.::||.|..|| ..:|....:|.:.|:|:.:.|
  Fly     1 MDFYYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEF-VKLNPQHTIPTLVDNGFSIWE 64

  Fly    70 NVAIFRHLAREKLVPEHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQQKWLVPYLQKTRPADN 134
            :.||..:|..:....::..|.....|:.|::.|.:   :||.....:  .|:..|..:..:|..:
  Fly    65 SRAIAVYLVEKYGKDDYLLPNDPKKRAVINQRLYF---DMGTLYESF--AKYYYPLFRTGKPGSD 124

  Fly   135 AVNLASKQLEHTLNEFEQLFLNSRKFMMGDNISYADLSAICEID--QPKSIGYNAFQNRNKLARW 197
            .   ..|::| |...|...||..::::.||.::.||::.:..:.  :.....::.:.|   ::||
  Fly   125 E---DLKRIE-TAFGFLDTFLEGQEYVAGDQLTVADIAILSTVSTFEVSEFDFSKYSN---VSRW 182

  Fly   198 YETVRE 203
            |:..::
  Fly   183 YDNAKK 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 17/74 (23%)
GST_C_Theta 95..220 CDD:198292 22/111 (20%)
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 17/73 (23%)
GST_C_Delta_Epsilon 88..204 CDD:198287 22/113 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459972
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
65.750

Return to query results.
Submit another query.