DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and GstD1

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster


Alignment Length:207 Identity:50/207 - (24%)
Similarity:95/207 - (45%) Gaps:18/207 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FDFLNQSSRALYILLEASKIPFEAIP--ISMLKGEHLTGEFRDNVNRFRKLPAITDHGYQLSENV 71
            |.:|..||....:::.|..:..|...  :::..||||..||. .:|....:|.:.|:|:.|.|:.
  Fly     4 FYYLPGSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFL-KINPQHTIPTLVDNGFALWESR 67

  Fly    72 AIFRHLAREKLVPEHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQQKWLVPYLQKTRPADNAV 136
            ||..:|..:....:..||:....|:.|::.|.:....:..:...|:     .|.:....|||.. 
  Fly    68 AIQVYLVEKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYY-----YPQVFAKAPADPE- 126

  Fly   137 NLASKQLEHTLNEFEQLFLNSRKFMMGDNISYADLSAICEID--QPKSIGYNAFQNRNKLARWYE 199
              |.|::|... ||...||..:.:..||:::.||::.:..:.  :......:.:.|.|   ||||
  Fly   127 --AFKKIEAAF-EFLNTFLEGQDYAAGDSLTVADIALVATVSTFEVAKFEISKYANVN---RWYE 185

  Fly   200 TVREELGPHYKE 211
            ..: ::.|.::|
  Fly   186 NAK-KVTPGWEE 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 21/72 (29%)
GST_C_Theta 95..220 CDD:198292 27/119 (23%)
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 21/71 (30%)
GstA 4..185 CDD:223698 46/193 (24%)
GST_C_Delta_Epsilon 89..205 CDD:198287 27/121 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459971
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
65.750

Return to query results.
Submit another query.