DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and GstD9

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster


Alignment Length:207 Identity:43/207 - (20%)
Similarity:93/207 - (44%) Gaps:10/207 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LKFYFDFLNQSSRALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGYQLSE 69
            |.||:...:...|::.:...|..:......:.:..||||..|| ..:|....:|.:.|.|:.:.|
  Fly     2 LDFYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEF-VKINPQHTIPTLVDDGFAIWE 65

  Fly    70 NVAIFRHLAREKLVPEHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQQKWLVPYLQKTRPADN 134
            :.||..:||.:.......||:....|:.|::.|.:..:.:..:...|:..: |...::|....||
  Fly    66 SRAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQ-LFEDVKKPADPDN 129

  Fly   135 AVNLASKQLEHTLNEFEQLFLNSRKFMMGDNISYADLSAICEIDQPKSIGYNAFQNRNKLARWYE 199
            .     |:::.....|..| |..:::...:.::.||.:.:..:...:...|: |....::.|||:
  Fly   130 L-----KKIDDAFAMFNTL-LKGQQYAALNKLTLADFALLATVSTFEISEYD-FGKYPEVVRWYD 187

  Fly   200 TVREELGPHYKE 211
            ..::.: |.::|
  Fly   188 NAKKVI-PGWEE 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 20/74 (27%)
GST_C_Theta 95..220 CDD:198292 21/117 (18%)
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 19/73 (26%)
GstA 4..187 CDD:223698 39/191 (20%)
GST_C_Delta_Epsilon 89..207 CDD:198287 21/119 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459975
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
65.750

Return to query results.
Submit another query.